Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29140 114 / 2e-32 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 112 / 6e-32 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 109 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 101 / 1e-27 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 87 / 7e-22 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 71 / 1e-15 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 44 / 8e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 43 / 2e-05 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 43 / 3e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017940 [exp] 307 / 1e-108 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 298 / 7e-105 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 207 / 6e-69 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 205 / 2e-68 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 107 / 8e-30 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 107 / 9e-30 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 105 / 6e-29 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 110 / 7e-29 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10026040 [exp] 86 / 3e-21 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G111300 [exp] 170 / 2e-54 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 155 / 7e-49 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 107 / 6e-30 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 104 / 6e-29 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 101 / 1e-27 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 100 / 5e-27 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 51 / 5e-08 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 45 / 4e-06 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 45 / 1e-05 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 42 / 7e-05 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10013681 pacid=23169108 polypeptide=Lus10013681 locus=Lus10013681.g ID=Lus10013681.BGIv1.0 annot-version=v1.0 ATGGCAAAGACAGCAGTAGTCGAAGTCGCCGCCTTTGCCCTCTTCCTCCTCGCCGCCACCTCCGCCACCGCCGCCGTCCAGAAGATGTTCGTGGAAGGCA AGGTTTACTGCGATCCTTGCCGTGTTGAGTTCCCCGTAGAAATCAGCACCTTTCTGCCAGGGGCGAAGGTGAACTTGCAATGCAGATGCAGGGAGAACAA GACAATAACGTACGAGGTGCAGGGAGAGACAGACAAGACAGGGAAGTACAGGCTACCGGTGGTTGCGGATCACGAGGAGGAGTTTTGCCAGGTGAAGCTG TTGGGGAGCCCCGAGGCGGACTGCAACGAGCAATTCAAGTTCATAGACCGAGCCATGGTGGTGCTCACCGACAACATGGGTATGGCTCAGTCGACCCGCT ACGCCAACGATATTGGCTACATGAAGTCCACCACCGACCCCCGTTGCGCCAAGATCTTGCAGGACATGGGATTGAACCTTCATTTGGAACAGACCAGGTT CTTGAATTTGGTCAAATCGTGA
AA sequence Show only first row Show all	>Lus10013681 pacid=23169108 polypeptide=Lus10013681 locus=Lus10013681.g ID=Lus10013681.BGIv1.0 annot-version=v1.0 MAKTAVVEVAAFALFLLAATSATAAVQKMFVEGKVYCDPCRVEFPVEISTFLPGAKVNLQCRCRENKTITYEVQGETDKTGKYRLPVVADHEEEFCQVKL LGSPEADCNEQFKFIDRAMVVLTDNMGMAQSTRYANDIGYMKSTTDPRCAKILQDMGLNLHLEQTRFLNLVKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29140			Pollen Ole e 1 allergen and ex...		Lus10013681 [exp]	0	1
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10013205 [exp]	9.6	0.9809
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Lus10036953 [exp]	10.9	0.9770
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004687 [exp]	12.5	0.9798
AT1G54215			proline-rich family protein (....		Lus10037669 [exp]	16.6	0.9794
AT1G12980	AP2_ERF	DRN, ESR1	ENHANCER OF SHOOT REGENERATION...		Lus10014345 [exp]	18.7	0.9787
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10018717 [exp]	18.8	0.9756
AT5G02030	HD	PNY, BLR, BLH9,...	VAAMANA, REPLUMLESS, PENNYWISE...		Lus10004688 [exp]	20.7	0.9783
AT5G56510		APUM12	pumilio 12 (.1)		Lus10024793 [exp]	21.4	0.9175
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10042506 [exp]	22.8	0.9776
AT2G42560			late embryogenesis abundant do...		Lus10002197 [exp]	26.8	0.9761

Compare expression of checked genes

Lus10013681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.