Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 175 / 5e-56 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 169 / 1e-53 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 161 / 4e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 157 / 2e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 157 / 6e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 154 / 5e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 155 / 2e-47 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 146 / 3e-45 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT5G26130 140 / 1e-42 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005557 [exp] 325 / 2e-115 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 169 / 6e-54 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 168 / 1e-53 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 166 / 2e-52 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 159 / 1e-49 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 158 / 2e-49 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 157 / 3e-49 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10025697 [exp] 146 / 7e-45 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 143 / 9e-44 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G007000 [exp] 216 / 3e-72 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 164 / 5e-52 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083300 [exp] 160 / 9e-51 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 160 / 1e-50 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 160 / 1e-50 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 154 / 5e-48 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 148 / 5e-46 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 147 / 5e-45 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.018G096028 [exp] 143 / 5e-43 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 140 / 1e-42 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10013693 pacid=23169044 polypeptide=Lus10013693 locus=Lus10013693.g ID=Lus10013693.BGIv1.0 annot-version=v1.0 ATGCCTACACTTAGCATCCTCTTCCCCTGCCTCTTCATCGGCCTCCTCTGCCTCACCACCTCTCTCCCTTCCACCGCACTCTCCGGACGAACGGCCGGCC GGAGAACCACCGCCAACACTCCACCCAACATAGTGAAGCAATTTCTATCCCCGCACAACAAAGAGCGAGCCAGGCTAGGAATCCCACCTTTGAAATGGAG CAACAAGCTAGCAAACTTCGCAGCGTCCTGGGCACGACAGCGCCGAGGAGACTGCCAGCTGGTCCACTCCCGCGGGAGGTACGGCGAGAACCTCTTCTGG GGGAGCGGTAGCAGGTGGCGGAGGGGTGACGCGGTGGCGGCGTGGGCCGCCGAGAGAAGCTACTACGACCACGCGGCGAATTCCTGTACGGAGAACAGAG ACTGCTTGCATTATACACAGATGATCTGGAGGCAGAGCACCCGAATTGGGTGTGCTAAGGTTGTTTGCACAAGTGGAGATACCTTCGTGAATTGTAACTA TGATCCTCCTGGGAATTTTGTTGGGGAGAAACCCTTTTGA
AA sequence Show only first row Show all	>Lus10013693 pacid=23169044 polypeptide=Lus10013693 locus=Lus10013693.g ID=Lus10013693.BGIv1.0 annot-version=v1.0 MPTLSILFPCLFIGLLCLTTSLPSTALSGRTAGRRTTANTPPNIVKQFLSPHNKERARLGIPPLKWSNKLANFAASWARQRRGDCQLVHSRGRYGENLFW GSGSRWRRGDAVAAWAAERSYYDHAANSCTENRDCLHYTQMIWRQSTRIGCAKVVCTSGDTFVNCNYDPPGNFVGEKPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31470			CAP (Cysteine-rich secretory p...		Lus10013693 [exp]	0	1
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10031470 [exp]	1.0	0.9772
AT5G03960		IQD12	IQ-domain 12 (.1)		Lus10018031 [exp]	3.5	0.9655
AT3G11590			unknown protein		Lus10013311 [exp]	5.1	0.9585
AT5G14020			Endosomal targeting BRO1-like ...		Lus10031997 [exp]	7.1	0.9656
AT3G58120	bZIP	ATBZIP61	Basic-leucine zipper (bZIP) tr...		Lus10039902 [exp]	7.4	0.9597
AT4G14090			UDP-Glycosyltransferase superf...		Lus10040591 [exp]	9.4	0.9520
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10033939 [exp]	9.8	0.9639
AT3G58120	bZIP	ATBZIP61	Basic-leucine zipper (bZIP) tr...		Lus10002185 [exp]	10.2	0.9578
AT1G64640		AtENODL8	early nodulin-like protein 8 (...		Lus10033227 [exp]	10.5	0.9648
AT1G64650			Major facilitator superfamily ...		Lus10000336 [exp]	13.1	0.9617

Compare expression of checked genes

Lus10013693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.