Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17120 94 / 3e-24 CAT8 cationic amino acid transporter 8 (.1) AT2G34960 81 / 2e-19 CAT5 cationic amino acid transporter 5 (.1) AT4G21120 68 / 5e-15 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) AT3G10600 53 / 1e-09 CAT7 cationic amino acid transporter 7 (.1) AT5G04770 52 / 2e-09 CAT6, ATCAT6 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005574 [exp] 140 / 7e-41 AT1G17120 811 / 0.0 cationic amino acid transporter 8 (.1) Lus10023271 [exp] 68 / 8e-15 AT4G21120 902 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10042817 [exp] 62 / 1e-12 AT4G21120 731 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10001581 [exp] 59 / 1e-11 AT4G21120 915 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10003697 [exp] 54 / 7e-10 AT4G21120 416 / 2e-140 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10040142 [exp] 38 / 0.0003 AT5G04770 547 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Lus10000962 [exp] 38 / 0.0003 AT5G04770 543 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G378500 [exp] 92 / 3e-23 AT1G17120 785 / 0.0 cationic amino acid transporter 8 (.1) Potri.003G154600 [exp] 80 / 5e-19 AT2G34960 870 / 0.0 cationic amino acid transporter 5 (.1) Potri.012G131300 [exp] 66 / 2e-14 AT4G21120 848 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.013G030900 [exp] 65 / 7e-14 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.013G030833 [exp] 65 / 7e-14 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.015G133100 [exp] 61 / 1e-12 AT4G21120 845 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.008G017100 [exp] 59 / 6e-12 AT3G10600 778 / 0.0 cationic amino acid transporter 7 (.1) Potri.010G241000 [exp] 58 / 1e-11 AT3G10600 781 / 0.0 cationic amino acid transporter 7 (.1) Potri.003G083700 [exp] 37 / 0.0007 AT5G04770 509 / 7e-176 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013705 pacid=23169089 polypeptide=Lus10013705 locus=Lus10013705.g ID=Lus10013705.BGIv1.0 annot-version=v1.0 ATGTTGCCAAAGCAACGGGCTGCCAAGGTGTGGGGGGTTCCGGTGGTGCCATGGCTGCCGGCATTGTCGATCGGGATGAATGTGTTTCTGATCGGCTCGC TGGGTTACTTGGTGTTCGTGAGGTTCTTCGTGTGCAGCGCAGTATTGGTGGTGTACTACTTGTTGGTTAGTGTTCATGCGACTCATGATGTTGCTAACCA GGAGCAAGGGGAGACCAAGCTTGAGGATGATACTATGACTTATTAG
AA sequence Show only first row Show all	>Lus10013705 pacid=23169089 polypeptide=Lus10013705 locus=Lus10013705.g ID=Lus10013705.BGIv1.0 annot-version=v1.0 MLPKQRAAKVWGVPVVPWLPALSIGMNVFLIGSLGYLVFVRFFVCSAVLVVYYLLVSVHATHDVANQEQGETKLEDDTMTY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17120		CAT8	cationic amino acid transporte...		Lus10013705 [exp]	0	1
AT3G49710			Pentatricopeptide repeat (PPR)...		Lus10006743 [exp]	15.1	0.6974
AT2G37630	MYB	AtPHAN, AtMYB91...	ARABIDOPSIS PHANTASTICA-LIKE 1...		Lus10024392 [exp]	15.7	0.7316
AT5G10310			unknown protein		Lus10025740 [exp]	30.6	0.6924
AT4G34940		ARO1	armadillo repeat only 1 (.1)		Lus10025059 [exp]	33.0	0.6864
AT2G40300		ATFER4	ferritin 4 (.1)		Lus10007523 [exp]	35.0	0.6834
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10027365 [exp]	35.2	0.6896
AT1G65730		YSL7	YELLOW STRIPE like 7 (.1)		Lus10005210 [exp]	44.4	0.6366
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Lus10016586 [exp]	44.9	0.6808
AT3G12550		FDM3	factor of DNA methylation 3, X...		Lus10000950 [exp]	56.7	0.6275
AT1G24625	C2H2ZnF	ZFP7	zinc finger protein 7 (.1)		Lus10003681 [exp]	56.9	0.6723

Compare expression of checked genes

Lus10013705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.