Lus10013721 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09760 275 / 4e-90 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G64640 238 / 2e-75 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G06830 153 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02330 152 / 3e-43 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G47550 149 / 4e-42 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G05610 150 / 7e-42 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G04960 147 / 2e-41 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G23200 146 / 5e-41 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G49180 145 / 2e-40 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G59010 144 / 2e-40 PME61, PME35 pectin methylesterase 61 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005587 340 / 6e-115 AT5G09760 689 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10033486 241 / 5e-77 AT5G09760 597 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10020888 194 / 4e-58 AT5G64630 563 / 0.0 FASCIATA 2, Transducin/WD40 repeat-like superfamily protein (.1.2.3)
Lus10010309 157 / 2e-45 AT1G02810 575 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10013416 155 / 1e-44 AT1G02810 519 / 2e-180 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027206 150 / 9e-43 AT2G45220 551 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10028536 140 / 3e-41 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10009110 142 / 2e-39 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10006103 138 / 2e-38 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G061500 288 / 5e-95 AT5G09760 717 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.007G107300 288 / 6e-95 AT5G09760 690 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G067100 154 / 4e-44 AT2G45220 691 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.010G109400 150 / 1e-42 AT1G23200 579 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G202600 150 / 2e-42 AT1G02810 749 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.014G127000 148 / 1e-41 AT1G02810 712 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.001G162400 148 / 1e-41 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Potri.012G126800 146 / 5e-41 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G145500 145 / 9e-41 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G127700 144 / 1e-40 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10013721 pacid=23169100 polypeptide=Lus10013721 locus=Lus10013721.g ID=Lus10013721.BGIv1.0 annot-version=v1.0
ATGTTCTCATTCATTGATCAAGCTCAAGTTTATACAATCGACGAGAAGGAAAATGACAAGACAAGGAGAATCAAAATCTCTGCAAACATTGCAGGTCTGG
AAATGTTTGCAGGTCTGGAAATGTTGTTACTGAATTCTCAGGAGCTGGATTGCCAGCTGCGAGGCAATGTGGACTTCATATTCGGCAACTCGGCCGCCAT
CTTCGACGACTGCACAATCTTGGTGGCTCCGAGGCAAGTGATGCCGGATAAAGGCGAGAACAACGCGGTGACTGCTCAGGGCAGGACGGATCCTGCTCAG
TCGACAGGGTTCGTGTTCCACAACTGCTTGATTAATGGCACCGAGGAGTACATGAGGCTGTACCGTAGTAACCCCAAGGTGCACAAGAACTTCCTGGGAC
GACCCTGGAAGGAGTATTCCAGGACTGTTTTCATTCGTTGCAACATGGAAGCACTGGTGAGCGCTCCAGGATGGATGCCGTGGAGTGGAGATTTTGCGTT
GGCGACTCTGTATTACGGGGAGTTTGAGAATTCCGGTGATGGTGGGTCGGATTGGTCGCAGAGGGTGAGTTGGAGTAGTCAAGTACCCAAGGAGCATGTG
GATGCTTACTCAGTAGATAATTTCATTCAAGGGAATCAGTGGATTCCCACCATTTGA
AA sequence
>Lus10013721 pacid=23169100 polypeptide=Lus10013721 locus=Lus10013721.g ID=Lus10013721.BGIv1.0 annot-version=v1.0
MFSFIDQAQVYTIDEKENDKTRRIKISANIAGLEMFAGLEMLLLNSQELDCQLRGNVDFIFGNSAAIFDDCTILVAPRQVMPDKGENNAVTAQGRTDPAQ
STGFVFHNCLINGTEEYMRLYRSNPKVHKNFLGRPWKEYSRTVFIRCNMEALVSAPGWMPWSGDFALATLYYGEFENSGDGGSDWSQRVSWSSQVPKEHV
DAYSVDNFIQGNQWIPTI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09760 Plant invertase/pectin methyle... Lus10013721 0 1
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10035859 2.0 0.8300
AT5G57770 Plant protein of unknown funct... Lus10019972 2.4 0.7959
AT3G61490 Pectin lyase-like superfamily ... Lus10007922 2.4 0.8412
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10017721 3.2 0.7774
AT5G55830 Concanavalin A-like lectin pro... Lus10022521 5.7 0.7383
AT1G72210 bHLH bHLH096 basic helix-loop-helix (bHLH) ... Lus10029950 6.6 0.7940
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10022378 7.4 0.7928
AT5G09760 Plant invertase/pectin methyle... Lus10013720 8.1 0.7926
AT5G09760 Plant invertase/pectin methyle... Lus10005587 8.8 0.7872
AT1G10640 Pectin lyase-like superfamily ... Lus10013025 12.7 0.6407

Lus10013721 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.