Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14420 170 / 2e-53 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) AT3G14415 168 / 2e-52 Aldolase-type TIM barrel family protein (.1.2.3) AT4G18360 160 / 9e-50 Aldolase-type TIM barrel family protein (.1.2) AT3G14130 121 / 1e-34 Aldolase-type TIM barrel family protein (.1) AT3G14150 120 / 5e-34 Aldolase-type TIM barrel family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013725 [exp] 194 / 2e-62 AT3G14420 675 / 0.0 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Lus10005590 [exp] 194 / 2e-62 AT3G14420 675 / 0.0 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Lus10023302 [exp] 161 / 1e-49 AT4G18360 664 / 0.0 Aldolase-type TIM barrel family protein (.1.2) Lus10038507 [exp] 158 / 1e-48 AT4G18360 665 / 0.0 Aldolase-type TIM barrel family protein (.1.2) Lus10042495 [exp] 149 / 3e-46 AT4G18360 461 / 1e-164 Aldolase-type TIM barrel family protein (.1.2) Lus10013173 [exp] 126 / 3e-38 AT3G14130 246 / 7e-82 Aldolase-type TIM barrel family protein (.1) Lus10008133 [exp] 127 / 6e-37 AT3G14130 518 / 0.0 Aldolase-type TIM barrel family protein (.1) Lus10036720 [exp] 122 / 6e-37 AT3G14420 133 / 4e-40 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Lus10013171 [exp] 123 / 2e-35 AT3G14130 521 / 0.0 Aldolase-type TIM barrel family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G112700 [exp] 171 / 2e-53 AT3G14420 669 / 0.0 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Potri.001G394400 [exp] 164 / 4e-51 AT3G14420 668 / 0.0 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Potri.004G065200 [exp] 163 / 1e-50 AT3G14420 651 / 0.0 Aldolase-type TIM barrel family protein (.1.2.3.4.5.6) Potri.003G069400 [exp] 122 / 8e-35 AT3G14130 529 / 0.0 Aldolase-type TIM barrel family protein (.1) Potri.003G069600 [exp] 122 / 8e-35 AT3G14130 502 / 2e-179 Aldolase-type TIM barrel family protein (.1) Potri.003G069300 [exp] 122 / 9e-35 AT3G14130 518 / 0.0 Aldolase-type TIM barrel family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0036 [flax] [poplar] TIM_barrel PF01070 [flax] [poplar] FMN_dh FMN-dependent dehydrogenase
Representative CDS sequence Show only first row Show all	>Lus10013724 pacid=23169139 polypeptide=Lus10013724 locus=Lus10013724.g ID=Lus10013724.BGIv1.0 annot-version=v1.0 ATGGACGACGGGAACAGAGGTGCACAAGGCCGGATTCCGGTGTTCTTGGATGGTGGCGTTAGGCGTGGCACAGATGTCTTCAAGGCATTGGCACTTGGTG CCTCTGGCATATTCATTGGACGACCGGTGGTGTTCTCGTTGGCTGCTGAGGGAGAAGCTGGAGTGAAGAATGTGCTTCAGATGCTACGTGAGGAGTTTGA GCTAACAATGGCGCTCAGCGGATGCCGTTCTCTCAAGGAAATCACTAGGGACCATATCGTTACCGATTGGGACACTCCTCGCCTCACATCCGCCAGGCTA TGA
AA sequence Show only first row Show all	>Lus10013724 pacid=23169139 polypeptide=Lus10013724 locus=Lus10013724.g ID=Lus10013724.BGIv1.0 annot-version=v1.0 MDDGNRGAQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGEAGVKNVLQMLREEFELTMALSGCRSLKEITRDHIVTDWDTPRLTSARL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14420			Aldolase-type TIM barrel famil...		Lus10013724 [exp]	0	1
AT2G22780		PMDH1	peroxisomal NAD-malate dehydro...		Lus10012459 [exp]	2.8	0.9495
AT2G01918		PQL3	PsbQ-like 3 (.1)		Lus10002286 [exp]	3.9	0.9380
AT1G19670		CORI1, ATHCOR1,...	CORONATINE-INDUCED PROTEIN 1, ...		Lus10014702 [exp]	6.0	0.9105
AT2G46820		PSI-P, TMP14, P...	THYLAKOID MEMBRANE PHOSPHOPROT...		Lus10002673 [exp]	7.5	0.9399
AT4G22950	MADS	AGL19	AGAMOUS-like 19 (.1)		Lus10014143 [exp]	7.7	0.9205
AT1G18730		PnsB4, NDF6	Photosynthetic NDH subcomplex...		Lus10001645 [exp]	11.0	0.9318
AT4G37925		NdhM, NDH-M	NADH dehydrogenase-like comple...		Lus10042759 [exp]	11.7	0.9111
AT5G67385			Phototropic-responsive NPH3 fa...		Lus10011532 [exp]	13.8	0.8955
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Lus10027246 [exp]	14.1	0.9265
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10010066 [exp]	14.7	0.8502

Compare expression of checked genes

Lus10013724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.