Lus10013730 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 169 / 4e-53 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 117 / 1e-32 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 107 / 1e-28 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 91 / 1e-22 ATDR4 drought-repressed 4 (.1)
AT1G72290 50 / 2e-07 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013731 370 / 9e-131 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 361 / 9e-129 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 352 / 6e-125 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 336 / 8e-117 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 328 / 8e-116 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 324 / 5e-114 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 319 / 5e-112 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 317 / 2e-111 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 311 / 6e-109 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 197 / 4e-64 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 196 / 1e-63 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 191 / 7e-62 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 184 / 7e-59 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 179 / 9e-57 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 164 / 2e-51 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 134 / 3e-39 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 86 / 1e-20 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 84 / 6e-20 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G000400 82 / 2e-19 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10013730 pacid=23169048 polypeptide=Lus10013730 locus=Lus10013730.g ID=Lus10013730.BGIv1.0 annot-version=v1.0
ATGCTACTCACAATCTCTTCATTCACCATACTCCTCATCTCCTTCACCACGCTTTCATCCGCCGCATCATCCCCAACTCCCGTCACCGACGTCGACGGCA
CACCCCTCCGGTCAGGCCTCAAGTACTTCATCCTCCCATCCGTCTCCGGAAACGGCGGGGGCATCTTTCTAGACACAACCAAGACCCAAAAATGCCCTCT
CTCCGTCTTCCAAGACGACTACGAGCTCTCCAAGGGTCTCCCGGTAGTTTTCCTGCCTGTCAACGCCAAGCCAGGCTACACAGTCCAGACGAACACCGAC
CTCAACATCGAGTTCACAGCAGAGACTGCGTGCGACGAAGCCCCCGTGTGGAAGGTGGAGAGTTACGACCATGATGTTAAGCAGTGGTTCATCGGGACCG
GTGGGGTCGAAGGGAAGCCTGGTCCGAGGACTGTGGACAGCTGGTTTAAGATTGTGAAATACGGAGGGAACTACAAGCTCGTGTATTGTCCTTCTGTGTG
CAAGTCGTGTAAAGTTCAGTGTAAGGATGTCGGGGTTTATGTGGATGAAGATGGCAAGAAGAGGCTTGCCCTTACTGATGATGACCCTTCCATTGTTAAG
TTCATGAAAGCTTCTAACAAGTAG
AA sequence
>Lus10013730 pacid=23169048 polypeptide=Lus10013730 locus=Lus10013730.g ID=Lus10013730.BGIv1.0 annot-version=v1.0
MLLTISSFTILLISFTTLSSAASSPTPVTDVDGTPLRSGLKYFILPSVSGNGGGIFLDTTKTQKCPLSVFQDDYELSKGLPVVFLPVNAKPGYTVQTNTD
LNIEFTAETACDEAPVWKVESYDHDVKQWFIGTGGVEGKPGPRTVDSWFKIVKYGGNYKLVYCPSVCKSCKVQCKDVGVYVDEDGKKRLALTDDDPSIVK
FMKASNK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10013730 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10039210 2.0 0.9902
AT1G17860 Kunitz family trypsin and prot... Lus10013731 2.8 0.9862
AT1G17860 Kunitz family trypsin and prot... Lus10013770 3.5 0.9777
AT1G17860 Kunitz family trypsin and prot... Lus10007892 4.2 0.9842
AT1G17860 Kunitz family trypsin and prot... Lus10030355 5.1 0.9672
AT1G17860 Kunitz family trypsin and prot... Lus10039209 5.5 0.9724
AT1G17860 Kunitz family trypsin and prot... Lus10042301 5.7 0.9841
AT1G17860 Kunitz family trypsin and prot... Lus10022302 6.7 0.9823
AT4G37390 AUR3, YDK1, GH3... YADOKARI 1, AUXIN UPREGULATED ... Lus10010391 8.5 0.9707
AT1G17860 Kunitz family trypsin and prot... Lus10007890 8.8 0.9711

Lus10013730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.