Lus10013731 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 169 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 115 / 8e-31 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 106 / 3e-27 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 89 / 7e-21 ATDR4 drought-repressed 4 (.1)
AT1G72290 54 / 3e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013730 377 / 3e-133 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 369 / 5e-130 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 356 / 3e-125 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 335 / 2e-116 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 338 / 4e-116 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 330 / 2e-114 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 322 / 1e-111 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 321 / 5e-111 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 316 / 2e-109 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 200 / 1e-63 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 198 / 3e-63 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 194 / 1e-61 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 187 / 1e-58 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 178 / 6e-55 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 167 / 1e-50 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 138 / 1e-39 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 87 / 3e-20 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 83 / 6e-19 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G000400 82 / 2e-18 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10013731 pacid=23169098 polypeptide=Lus10013731 locus=Lus10013731.g ID=Lus10013731.BGIv1.0 annot-version=v1.0
ATGGTCGGACCAGAAGCAGAATTCATGCGGGTTTTCAAATACAATCACATCCTTAAGCTGTGGCAGAGTCTTGATAGCATCGAAGATCAAGTGGCTCTTC
TGAGTCCCACTTCGTCCATGATTCTATCATGCAAGGAGCTTCAAGCTAAGGGATTAGAGAACGCCATTCACCTCCCGAGATTCCATGGCCCCTACAACGT
CTACTACTCGTTGTCGACTAAGGAATTTACATCAACGGAACGTCCATTGAACTGCACTTGGATGCCAGCTAATTACAAGAAATACATTATGAAGACAACA
ACAATAATGCTACTCACAATCTCTTCATTCACCATACTCCTTATCTCCTTCACCACGCTTTCATCCGCCGCATCGTCCCCAACTCCCGTCACCGACGTCG
ACGGCACACCCCTCCGGTCAGGCCTCAAGTACTTCATCCGCCCATCCGTCTCCGGAAACGGCGGGGGCATCTTTCTAGACACAACCAAGACCCAAAAATG
CCCTCTCTCCGTCTTCCAAGACGACTACGAGCTCTCCAAGGGTCTCCCGGTAGTTTTCCTGCCTGTCAACGCCAAGCCAGGCTACACAGTCCAGACGAAC
ACCGACCTCAACATCGAGTTCACAGCAGAGACTGCGTGCGACGAAGCCCCCGTGTGGAAGGTGGAGAGTTACGACCATGATGTTAAGCAGTGGTTCGTCG
GGACCGGTGGGGTCGAAGGGAAGCCTGGTCCGAGGACTGTGGACAGCTGGTTTAAGATTGTGAAATACGGAGGGAACTACAAGCTCGTGTATTGTCCTTC
TGTGTGCAAGTCGTGTAAAGTTCAGTGTAAGGATGTCGGGGTTTATGTGGATGAAGATGGCAAGAAGAGGCTTGCCCTTACTGATGATGACCCTTCCATT
GTTAAGTTCATGAAAGCTTCTAACAAGTAG
AA sequence
>Lus10013731 pacid=23169098 polypeptide=Lus10013731 locus=Lus10013731.g ID=Lus10013731.BGIv1.0 annot-version=v1.0
MVGPEAEFMRVFKYNHILKLWQSLDSIEDQVALLSPTSSMILSCKELQAKGLENAIHLPRFHGPYNVYYSLSTKEFTSTERPLNCTWMPANYKKYIMKTT
TIMLLTISSFTILLISFTTLSSAASSPTPVTDVDGTPLRSGLKYFIRPSVSGNGGGIFLDTTKTQKCPLSVFQDDYELSKGLPVVFLPVNAKPGYTVQTN
TDLNIEFTAETACDEAPVWKVESYDHDVKQWFVGTGGVEGKPGPRTVDSWFKIVKYGGNYKLVYCPSVCKSCKVQCKDVGVYVDEDGKKRLALTDDDPSI
VKFMKASNK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10013731 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10007892 1.0 0.9946
AT1G17860 Kunitz family trypsin and prot... Lus10039210 2.4 0.9910
AT1G17860 Kunitz family trypsin and prot... Lus10013730 2.8 0.9862
AT1G17860 Kunitz family trypsin and prot... Lus10022302 4.6 0.9864
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10001103 4.9 0.9842
AT1G62420 Protein of unknown function (D... Lus10003258 5.5 0.9790
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 6.7 0.9853
AT3G28210 SAP12, PMZ STRESS-ASSOCIATED PROTEIN 12, ... Lus10039469 7.5 0.9833
AT1G17860 Kunitz family trypsin and prot... Lus10007902 9.4 0.9831
Lus10027144 9.9 0.9623

Lus10013731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.