Lus10013732 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 117 / 8e-33 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 113 / 3e-31 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 82 / 3e-19 ATDR4 drought-repressed 4 (.1)
AT1G72290 56 / 2e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039208 411 / 2e-148 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 379 / 1e-135 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 363 / 2e-129 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 356 / 9e-127 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 356 / 1e-126 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 358 / 6e-126 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 355 / 1e-124 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 335 / 4e-118 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 329 / 7e-116 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 197 / 5e-64 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 196 / 2e-63 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 191 / 2e-61 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 188 / 2e-60 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 184 / 5e-59 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 163 / 8e-51 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 143 / 6e-43 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 96 / 1e-24 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G000400 84 / 5e-20 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111500 82 / 4e-19 AT1G73260 79 / 5e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10013732 pacid=23169080 polypeptide=Lus10013732 locus=Lus10013732.g ID=Lus10013732.BGIv1.0 annot-version=v1.0
ATGAAGACAACAATGCTACTTGCAATCTCTTCATTCATCATAGTCCTTGTCTCCTTTACCACACTTTCTTCCGCCGCTTCATTCCCGACTACTGTCACTG
ACATCGATGGCGCACCCCTCCGCTCGGGCCGCAAGTACTTCATCCTCCCATCCGTCTCCGGGGACGGGGGCGGACTAGCTCTAGGAAGAAGAACCGATAC
AAAGAAATGCCCGCTCTCCGTCATCCAGGACGACTACGAGCTCTCCAAGGGTATTCCGGTAGTTTTCCTGCCCATCAACTCAAAGCCGGGCTACACCGTT
CGAACTGACACCGATCTCAACATCGAGTTCACTACAGAGACGGCATGTGACGAAGCCCCCGTGTGGAAGGTGGAGAGTTATGACCATGACGTCAGCCAGT
GGTTCATTGGCACCGGTGGTATCGAAGGAAAGCCCGGTCCGAGGACTGTGGATAACTGGTTTAAGATTGACAATTACGGCGGGAACTACAAGCTCGTGTA
CTGCCCTTCTGTGTGCAAGACTTGCAAGGTTCAGTGTAAGGATGTCGGGGTTTACGTGGATGAATATGGCAAGAAGAGGCTTGCTCTTACTGACGATGAG
CCTTCCATTGTTAAGTTCATGAAAGCTCCCAAATAG
AA sequence
>Lus10013732 pacid=23169080 polypeptide=Lus10013732 locus=Lus10013732.g ID=Lus10013732.BGIv1.0 annot-version=v1.0
MKTTMLLAISSFIIVLVSFTTLSSAASFPTTVTDIDGAPLRSGRKYFILPSVSGDGGGLALGRRTDTKKCPLSVIQDDYELSKGIPVVFLPINSKPGYTV
RTDTDLNIEFTTETACDEAPVWKVESYDHDVSQWFIGTGGIEGKPGPRTVDNWFKIDNYGGNYKLVYCPSVCKTCKVQCKDVGVYVDEYGKKRLALTDDE
PSIVKFMKAPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10013732 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10011090 1.0 0.9788
Lus10027144 3.3 0.9656
AT1G17860 Kunitz family trypsin and prot... Lus10039208 3.7 0.9677
Lus10022008 5.9 0.9692
AT5G39150 RmlC-like cupins superfamily p... Lus10006536 7.6 0.9738
AT1G17860 Kunitz family trypsin and prot... Lus10007892 8.7 0.9712
AT5G13080 WRKY ATWRKY75, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Lus10011346 16.0 0.9713
AT1G17860 Kunitz family trypsin and prot... Lus10013731 16.2 0.9673
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10021394 16.5 0.9629
AT1G14540 Peroxidase superfamily protein... Lus10000003 18.2 0.9624

Lus10013732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.