Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09250 118 / 5e-36 KIWI ssDNA-binding transcriptional regulator (.1.2) AT5G09240 81 / 4e-21 ssDNA-binding transcriptional regulator (.1.2.3) AT4G10920 72 / 5e-17 KELP transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039207 [exp] 152 / 2e-49 AT5G09250 125 / 1e-38 ssDNA-binding transcriptional regulator (.1.2) Lus10032410 [exp] 75 / 3e-18 AT4G10920 169 / 2e-54 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10030245 [exp] 62 / 3e-13 AT4G10920 136 / 3e-41 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10003998 [exp] 59 / 4e-11 AT4G00980 226 / 9e-68 zinc knuckle (CCHC-type) family protein (.1) Lus10023061 [exp] 56 / 7e-11 AT4G10920 132 / 7e-40 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G101100 [exp] 103 / 3e-30 AT5G09250 115 / 7e-35 ssDNA-binding transcriptional regulator (.1.2) Potri.002G171900 [exp] 67 / 2e-14 AT4G00980 373 / 7e-125 zinc knuckle (CCHC-type) family protein (.1) Potri.001G089400 [exp] 65 / 2e-14 AT4G10920 152 / 5e-48 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0609 [flax] [poplar] sPC4_like PF02229 [flax] [poplar] PC4 Transcriptional Coactivator p15 (PC4)
Representative CDS sequence Show only first row Show all	>Lus10013733 pacid=23169119 polypeptide=Lus10013733 locus=Lus10013733.g ID=Lus10013733.BGIv1.0 annot-version=v1.0 ATGTCTGGAAGATACAAGCGGAAGGAGGTGGAAGAGAATGCGTCCGACGAGGACAGCCGTGCTCCTGCTCCAAAGAAAGCTTCCAAAGCTGATGCCTCGG AAGATTCTGACGAAATCGTGGTTTGCGATATATCTCACAACAGGAGAGTGAAAGTGAGGAACTGGCAGGGAAAGGTATGGGTGGACATTCGTGAGTTCTA CACCAAGGATGGGAAGCAGCTCCCTGGGAAGAAAGGCATATCTCTGAGCGTGGATCAGTGGAAGACCCTGAAGGATCACGCTGAAGCAATTGACAAGGCA CTTGCTGATTCTTGA
AA sequence Show only first row Show all	>Lus10013733 pacid=23169119 polypeptide=Lus10013733 locus=Lus10013733.g ID=Lus10013733.BGIv1.0 annot-version=v1.0 MSGRYKRKEVEENASDEDSRAPAPKKASKADASEDSDEIVVCDISHNRRVKVRNWQGKVWVDIREFYTKDGKQLPGKKGISLSVDQWKTLKDHAEAIDKA LADS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10013733 [exp]	0	1
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	2.0	0.9052
AT3G09860			unknown protein		Lus10001400 [exp]	2.4	0.8971
AT4G15950		RDM2, NRPE4, NR...	RNA-DIRECTED DNA METHYLATION 2...		Lus10038766 [exp]	2.4	0.9046
AT3G18430			Calcium-binding EF-hand family...		Lus10010775 [exp]	2.8	0.8771
AT3G61790			Protein with RING/U-box and TR...		Lus10002761 [exp]	4.5	0.8530
AT2G41530		ATSFGH	ARABIDOPSIS THALIANA S-FORMYLG...		Lus10042038 [exp]	4.9	0.8633
AT5G40530			S-adenosyl-L-methionine-depend...		Lus10022276 [exp]	5.3	0.8674
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10041349 [exp]	6.6	0.8515
AT1G06980			unknown protein		Lus10006211 [exp]	8.4	0.8731
AT1G68080			2-oxoglutarate (2OG) and Fe(II...		Lus10019134 [exp]	9.4	0.7901

Compare expression of checked genes

Lus10013733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.