Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31945 70 / 5e-17 unknown protein AT1G05575 54 / 5e-11 unknown protein AT1G55207 54 / 6e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039201 [exp] 141 / 2e-45 AT2G31945 69 / 7e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G215300 [exp] 79 / 9e-21 AT2G31945 67 / 2e-16 unknown protein Potri.001G010600 [exp] 77 / 6e-20 AT2G31945 62 / 2e-14 unknown protein Potri.009G024300 [exp] 71 / 1e-17 AT2G31945 84 / 8e-23 unknown protein Potri.001G230900 [exp] 70 / 5e-17 AT2G31945 79 / 1e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013740 pacid=23169070 polypeptide=Lus10013740 locus=Lus10013740.g ID=Lus10013740.BGIv1.0 annot-version=v1.0 ATGGAGCTTCTGGGTCAAACAATGGCAGCAGATGTGTTGACCAAAGTCGGCATCTTTATACTCGTGCAGGCCTTGGTGTACCTCGTCCTCACAACTTCCT CCACCGTCTTCTCCAAGAACATCAAGCGATCTTTCAGCTTCAAGCCGGCTCGCTCCGTCAGCATCCGCCGCATGTTCGCCGCCATCTCCGATGTCCCCGC CGTTTCTGGTGCGAGCGTGATGATCGGAAGGACGGCTTCTTCTGCTTACGTTCGGCAGTCTGATCCCATTTTTGGGGATGTTGGGTATTGA
AA sequence Show only first row Show all	>Lus10013740 pacid=23169070 polypeptide=Lus10013740 locus=Lus10013740.g ID=Lus10013740.BGIv1.0 annot-version=v1.0 MELLGQTMAADVLTKVGIFILVQALVYLVLTTSSTVFSKNIKRSFSFKPARSVSIRRMFAAISDVPAVSGASVMIGRTASSAYVRQSDPIFGDVGY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31945			unknown protein		Lus10013740 [exp]	0	1
AT2G31945			unknown protein		Lus10039201 [exp]	1.7	0.9610
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10010534 [exp]	7.1	0.9635
AT3G25610			ATPase E1-E2 type family prote...		Lus10034404 [exp]	7.4	0.9581
AT2G41480			Peroxidase superfamily protein...		Lus10020422 [exp]	7.7	0.9392
AT5G57510			unknown protein		Lus10028472 [exp]	8.1	0.9623
AT5G36930			Disease resistance protein (TI...		Lus10014671 [exp]	9.2	0.9586
AT4G15440		CYP74B2, HPL1	hydroperoxide lyase 1 (.1)		Lus10030033 [exp]	10.5	0.9516
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10033366 [exp]	11.4	0.9511
					Lus10020728 [exp]	11.5	0.9480
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10008881 [exp]	12.2	0.9421

Compare expression of checked genes

Lus10013740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.