Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G018700 [exp] 41 / 1e-05 AT5G42190 249 / 6e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [flax] [poplar] POZ PF03931 [flax] [poplar] Skp1_POZ Skp1 family, tetramerisation domain
Representative CDS sequence Show only first row Show all	>Lus10013743 pacid=23169117 polypeptide=Lus10013743 locus=Lus10013743.g ID=Lus10013743.BGIv1.0 annot-version=v1.0 ATGAATCGAATAGGAACAGAAGCATCTGGATCGGAAACTTTCACCTTGGAAACCCACGACGGCCGATCGTTTGTAATGGACAAAGCTGTGGCCAAGCAGT CGAGCATGTGCCATCGTATGATGAATCATGGTTGGGACTCCATCTCGTTAGATATAGAAATCAGCGACAAGACTCTCGAGAAGGTGATCGGGTACTGTGT AGGATATGACCGCTCTGACGACTTCAATATGGCTTAG
AA sequence Show only first row Show all	>Lus10013743 pacid=23169117 polypeptide=Lus10013743 locus=Lus10013743.g ID=Lus10013743.BGIv1.0 annot-version=v1.0 MNRIGTEASGSETFTLETHDGRSFVMDKAVAKQSSMCHRMMNHGWDSISLDIEISDKTLEKVIGYCVGYDRSDDFNMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013743 [exp]	0	1
AT1G21550			Calcium-binding EF-hand family...		Lus10040888 [exp]	2.0	0.7333
AT2G25930		PYK20, ELF3	EARLY FLOWERING 3, hydroxyprol...		Lus10006857 [exp]	10.9	0.7423
					Lus10019586 [exp]	11.9	0.6579
AT5G46230			Protein of unknown function, D...		Lus10033612 [exp]	15.4	0.7367
AT3G14880			unknown protein		Lus10039196 [exp]	15.5	0.7374
AT5G60010			ferric reductase-like transmem...		Lus10019390 [exp]	25.2	0.7327
					Lus10006918 [exp]	27.6	0.7327
					Lus10027066 [exp]	29.8	0.7327
AT5G41720			unknown protein		Lus10011415 [exp]	31.8	0.5705
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10015158 [exp]	31.9	0.7327

Compare expression of checked genes

Lus10013743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.