Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18690 51 / 5e-09 unknown protein AT4G18660 49 / 8e-09 unknown protein AT5G45830 46 / 4e-07 ATDOG1, GSQ5, DOG1 GLUCOSE SENSING QTL 5, delay of germination 1 (.1) AT4G18680 44 / 1e-06 unknown protein AT4G18650 42 / 1e-05 transcription factor-related (.1) AT3G14880 38 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039193 [exp] 103 / 1e-28 AT3G14880 135 / 5e-39 unknown protein Lus10042453 [exp] 86 / 9e-22 AT3G14880 145 / 3e-42 unknown protein Lus10039196 [exp] 84 / 4e-21 AT3G14880 135 / 1e-38 unknown protein Lus10013746 [exp] 80 / 1e-19 AT3G14880 141 / 5e-41 unknown protein Lus10013711 [exp] 53 / 1e-09 AT3G14880 251 / 2e-84 unknown protein Lus10015276 [exp] 49 / 5e-08 AT4G18690 204 / 6e-65 unknown protein Lus10005579 [exp] 47 / 2e-07 AT3G14880 121 / 1e-33 unknown protein Lus10028231 [exp] 37 / 0.0006 AT1G58330 154 / 8e-47 transcription factor-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G098800 [exp] 73 / 5e-17 AT3G14880 159 / 6e-48 unknown protein Potri.004G058200 [exp] 48 / 6e-08 AT4G18650 226 / 1e-74 transcription factor-related (.1) Potri.001G390100 [exp] 45 / 4e-07 AT3G14880 255 / 3e-86 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013747 pacid=23169138 polypeptide=Lus10013747 locus=Lus10013747.g ID=Lus10013747.BGIv1.0 annot-version=v1.0 ATGGCTTTTTTCTTACATTTCGTGTTTGAATTAAATGTTATATATAATTCATTGGCGAGTAAGGAGAAGAAACTGGTTCTGCGGGTGGCTGATGATCTGC GGCTGGCGACACGGTGTATTGTTGATGTGTTGACTCCGATCGAGGCCGTTCATTTCTTGATCGCGGTTGCTGAGCTTCATCTTCGGCTTCATGATTGGGG GAAGCGGAGGGACGCTACCGCACCATCGCAGCCGTCCATGTAG
AA sequence Show only first row Show all	>Lus10013747 pacid=23169138 polypeptide=Lus10013747 locus=Lus10013747.g ID=Lus10013747.BGIv1.0 annot-version=v1.0 MAFFLHFVFELNVIYNSLASKEKKLVLRVADDLRLATRCIVDVLTPIEAVHFLIAVAELHLRLHDWGKRRDATAPSQPSM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18660			unknown protein		Lus10013747 [exp]	0	1

Compare expression of checked genes

Lus10013747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.