Lus10013770 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 165 / 2e-51 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 124 / 2e-35 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 105 / 1e-27 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 81 / 8e-19 ATDR4 drought-repressed 4 (.1)
AT1G72290 47 / 2e-06 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039163 385 / 7e-138 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 366 / 3e-130 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 355 / 1e-125 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 352 / 1e-124 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 351 / 4e-124 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 347 / 9e-123 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 262 / 4e-89 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 250 / 2e-84 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 249 / 5e-84 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 213 / 3e-70 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 212 / 8e-70 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 207 / 6e-68 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 191 / 1e-61 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 185 / 5e-59 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 181 / 1e-57 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 151 / 1e-45 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.001G309900 91 / 2e-22 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 89 / 1e-21 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111800 81 / 7e-19 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10013770 pacid=23169074 polypeptide=Lus10013770 locus=Lus10013770.g ID=Lus10013770.BGIv1.0 annot-version=v1.0
ATGGCAGCAGCAGCAAATGCGATGCTACTCATTGTCCTAATCGCAATCGATACTCTCTCTACCGCCTCCGCCGCTCGATCGCTAGCCGAAACCCTAGCCA
CATCATCGCTGACACCGCTTCCCGTTTTGGACGTGGACGGGAAAGTGGTCCGTTCGGGGACCACTTACTACGTCCTTCCCGCAACTAGCGGGGAAGGCGG
TGGTGTGGCCATGGCCAGTAAGACCAACGACCCGGAGAGCTGCCCGTTGGCCGTGGTCCAGGACGACGACGAGCTCTCCCAAGGCTTGCCTCTCACTTTC
GGCCCGGTCAACACCAAGGTGGGCTACACTGTCCGTACGTTCACTGACATTAACGTCAAGTTCTCTGCCGATACGGCCTGCGACGAGGGGACGGTGTGGA
AGGTGGATGATTACGACGATGACGTGGAGCAGTGGTTTGTGGGAACCGGTGGGGTTGAAGGCAATCCTGGTCCGAGGACTGTGAAGAATTGGTTCAAGAT
TTGGAAGTACGGTTCGAACTATAAGTTTTCGTACTGCCCCGCGGTTTGCAAGTCGTGCAAGGTTGATTGCAAGGATGTCGGGATTTATGTGGATGAGAAT
GGTGGGAGGAGGTTGGCCTTGGTTGACAAGGAAGGTGATCCTTTTGTGGTCAAGTTTGTGAAGGCAACTTGA
AA sequence
>Lus10013770 pacid=23169074 polypeptide=Lus10013770 locus=Lus10013770.g ID=Lus10013770.BGIv1.0 annot-version=v1.0
MAAAANAMLLIVLIAIDTLSTASAARSLAETLATSSLTPLPVLDVDGKVVRSGTTYYVLPATSGEGGGVAMASKTNDPESCPLAVVQDDDELSQGLPLTF
GPVNTKVGYTVRTFTDINVKFSADTACDEGTVWKVDDYDDDVEQWFVGTGGVEGNPGPRTVKNWFKIWKYGSNYKFSYCPAVCKSCKVDCKDVGIYVDEN
GGRRLALVDKEGDPFVVKFVKAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10013770 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10039209 1.7 0.9757
AT1G17860 Kunitz family trypsin and prot... Lus10042301 3.0 0.9836
AT1G17860 Kunitz family trypsin and prot... Lus10013730 3.5 0.9777
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10002324 3.7 0.9634
AT1G17860 Kunitz family trypsin and prot... Lus10007890 4.9 0.9749
AT1G17860 Kunitz family trypsin and prot... Lus10039210 8.7 0.9732
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10026094 9.2 0.9605
AT4G20820 FAD-binding Berberine family p... Lus10032943 10.8 0.9278
AT1G17860 Kunitz family trypsin and prot... Lus10022302 11.2 0.9724
AT1G17860 Kunitz family trypsin and prot... Lus10013731 11.7 0.9710

Lus10013770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.