Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23530 95 / 7e-25 ATCXE18 carboxyesterase 18 (.1) AT5G27320 81 / 1e-19 ATGID1C, GID1C GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) AT3G05120 80 / 4e-19 ATGID1A, GID1A GA INSENSITIVE DWARF1A, alpha/beta-Hydrolases superfamily protein (.1) AT3G63010 71 / 5e-16 ATGID1B, GID1B GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) AT5G14310 50 / 2e-08 ATCXE16 carboxyesterase 16 (.1) AT5G06570 46 / 5e-07 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G27320 41 / 4e-05 alpha/beta-Hydrolases superfamily protein (.1.2) AT5G16080 39 / 0.0002 ATCXE17 carboxyesterase 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039162 [exp] 189 / 5e-61 AT5G23530 324 / 3e-110 carboxyesterase 18 (.1) Lus10013774 [exp] 100 / 2e-26 AT5G23530 315 / 2e-106 carboxyesterase 18 (.1) Lus10029542 [exp] 83 / 1e-22 AT5G23530 99 / 1e-26 carboxyesterase 18 (.1) Lus10039621 [exp] 81 / 7e-22 AT5G23530 97 / 5e-26 carboxyesterase 18 (.1) Lus10002254 [exp] 80 / 4e-19 AT5G27320 550 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Lus10000928 [exp] 80 / 4e-19 AT5G27320 553 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Lus10008189 [exp] 76 / 7e-19 AT3G63010 206 / 4e-67 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) Lus10027969 [exp] 74 / 1e-16 AT3G63010 566 / 0.0 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) Lus10002907 [exp] 58 / 3e-11 AT5G16080 204 / 3e-63 carboxyesterase 17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G014306 [exp] 124 / 5e-37 AT5G23530 0 / 1 carboxyesterase 18 (.1) Potri.019G014302 [exp] 124 / 6e-36 AT5G23530 329 / 3e-112 carboxyesterase 18 (.1) Potri.004G092500 [exp] 119 / 5e-34 AT5G23530 388 / 3e-135 carboxyesterase 18 (.1) Potri.001G459400 [exp] 110 / 2e-30 AT5G23530 327 / 1e-111 carboxyesterase 18 (.1) Potri.014G135900 [exp] 81 / 1e-19 AT3G63010 537 / 0.0 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) Potri.002G213100 [exp] 79 / 5e-19 AT3G63010 578 / 0.0 GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) Potri.013G028700 [exp] 76 / 2e-17 AT5G27320 608 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Potri.005G040600 [exp] 69 / 3e-15 AT5G27320 570 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Potri.009G155800 [exp] 48 / 1e-07 AT5G06570 310 / 4e-105 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.018G028300 [exp] 47 / 2e-07 AT1G68620 199 / 1e-61 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF07859 [flax] [poplar] Abhydrolase_3 alpha/beta hydrolase fold
Representative CDS sequence Show only first row Show all	>Lus10013771 pacid=23169120 polypeptide=Lus10013771 locus=Lus10013771.g ID=Lus10013771.BGIv1.0 annot-version=v1.0 ATGTGGAAGCAGTTCCTTCCCGAAGGTTCGGACAGGGATCATCCGGCGGTGCACGTTTTCGGGGAGGATATTAGTGGGGTGAAGGGGTTTCCGGCGACGG TGGTGTTCGTGGGAGGGTACGATCCGATCAAGGACTGGCAGAGGAAGTACTACGAGTGGCTGAAGAGAGGCGGGAAAGACGCGAGGATTGTTGAGTACGG GAATGCGATTCACACCTTTTACGCTTACCCTGAGATGCCGGAGTCGGCTCTGTTCGTCGACGAGGTGAGGAGTTTTGTGAACGCTTAA
AA sequence Show only first row Show all	>Lus10013771 pacid=23169120 polypeptide=Lus10013771 locus=Lus10013771.g ID=Lus10013771.BGIv1.0 annot-version=v1.0 MWKQFLPEGSDRDHPAVHVFGEDISGVKGFPATVVFVGGYDPIKDWQRKYYEWLKRGGKDARIVEYGNAIHTFYAYPEMPESALFVDEVRSFVNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Lus10013771 [exp]	0	1
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Lus10013041 [exp]	15.7	0.8574
AT3G63190		HFP108, AtcpRRF...	"ribosome recycling factor, ch...		Lus10042587 [exp]	22.5	0.8466
AT4G19100		PAM68	photosynthesis affected mutant...		Lus10012152 [exp]	27.6	0.8460
AT3G27690		LHCB2.3, LHCB2:...	LIGHT-HARVESTING CHLOROPHYLL B...		Lus10001741 [exp]	28.5	0.8386
AT4G09010		TL29, APX4	thylakoid lumen 29, ascorbate ...		Lus10020942 [exp]	44.8	0.8344
AT1G64150			Uncharacterized protein family...		Lus10024713 [exp]	51.6	0.8337
AT3G10050		OMR1	L-O-methylthreonine resistant ...		Lus10005369 [exp]	53.9	0.8214
					Lus10025623 [exp]	58.0	0.8175
AT1G51400			Photosystem II 5 kD protein (....		Lus10009950 [exp]	60.5	0.8289
AT1G65260		VIPP1, PTAC4	VESICLE-INDUCING PROTEIN IN PL...		Lus10025601 [exp]	69.6	0.8239

Compare expression of checked genes

Lus10013771 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.