Lus10013783 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07820 72 / 4e-15 Pectin lyase-like superfamily protein (.1)
AT3G59850 68 / 1e-13 Pectin lyase-like superfamily protein (.1)
AT1G78400 67 / 2e-13 Pectin lyase-like superfamily protein (.1)
AT2G33160 67 / 2e-13 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein (.1)
AT1G02790 66 / 5e-13 PGA4 polygalacturonase 4 (.1)
AT2G43890 64 / 2e-12 Pectin lyase-like superfamily protein (.1)
AT1G17150 64 / 2e-12 Pectin lyase-like superfamily protein (.1)
AT1G05650 64 / 4e-12 Pectin lyase-like superfamily protein (.1)
AT5G48140 63 / 4e-12 Pectin lyase-like superfamily protein (.1)
AT1G43090 63 / 7e-12 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013784 204 / 4e-65 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10013780 204 / 4e-65 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10039154 197 / 4e-62 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1)
Lus10003001 101 / 2e-25 AT3G07840 362 / 1e-118 Pectin lyase-like superfamily protein (.1)
Lus10043088 99 / 4e-25 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1)
Lus10009606 96 / 2e-23 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1)
Lus10041058 86 / 6e-20 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10041059 86 / 6e-20 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1)
Lus10002931 84 / 3e-19 AT3G07820 233 / 6e-73 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G066800 79 / 1e-17 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067000 79 / 1e-17 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067050 79 / 1e-17 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1)
Potri.002G202200 77 / 5e-17 AT1G02790 400 / 7e-138 polygalacturonase 4 (.1)
Potri.002G202100 77 / 5e-17 AT1G02790 399 / 2e-137 polygalacturonase 4 (.1)
Potri.019G067100 76 / 2e-16 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1)
Potri.019G067133 76 / 2e-16 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067200 76 / 2e-16 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.019G067166 76 / 2e-16 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1)
Potri.007G144400 75 / 3e-16 AT3G59850 476 / 2e-168 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10013783 pacid=23169041 polypeptide=Lus10013783 locus=Lus10013783.g ID=Lus10013783.BGIv1.0 annot-version=v1.0
ATGGAGAAAACAGGTTCTGGTAGTAGCATCATGGCAACGTTCTTGCTCCTGGTTTTGTTTACATTTGCAAACGTGGTTAGTGCCCAACGTGGTGCGGCTC
AACCCGGCATGCCGGAAGCTGGTGGAGCCGCACCACCCGCCGGTGGCGGGTTTGATATATGCAAATATGGTGCAGTAGCCGATGAGAAAACAGACATTAC
TCAAGCGCTGACAAAAGCATTTAAAGAAGCATGCGCATCAACAGCACCCGCAACAGTACTAATTCCACCGGGCAACTACTTATGTGGCCAAACCGACTTG
AAAGCCCCTTGCACAGCTCCTTCGATCACCTTCCAAGTCCAGGGAACTATTAGGGCCCCTTCAAACATTGCTGGTGATACTTGGTTCCTCTTTGACAACA
TCAACAACTTGAACATCGTTGGTGGTGGCATTTTCGATGGCCAAGGTCCCACCTGTTACAAGACCAAGAAATCCGTTGCTGTGGTACGTGTTTGTATGCT
ATGA
AA sequence
>Lus10013783 pacid=23169041 polypeptide=Lus10013783 locus=Lus10013783.g ID=Lus10013783.BGIv1.0 annot-version=v1.0
MEKTGSGSSIMATFLLLVLFTFANVVSAQRGAAQPGMPEAGGAAPPAGGGFDICKYGAVADEKTDITQALTKAFKEACASTAPATVLIPPGNYLCGQTDL
KAPCTAPSITFQVQGTIRAPSNIAGDTWFLFDNINNLNIVGGGIFDGQGPTCYKTKKSVAVVRVCML

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07820 Pectin lyase-like superfamily ... Lus10013783 0 1
Lus10015249 12.3 0.5608
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10041540 16.7 0.5445
AT3G59500 Integral membrane HRF1 family ... Lus10008752 22.0 0.4939
AT2G17030 F-box family protein with a do... Lus10022619 30.4 0.4749
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693 32.1 0.4747
AT5G18460 Protein of Unknown Function (D... Lus10006861 33.4 0.4747
AT5G12060 Plant self-incompatibility pro... Lus10023085 34.7 0.4747
AT2G39730 RCA rubisco activase (.1.2.3) Lus10035616 35.3 0.4741
AT2G03630 unknown protein Lus10026665 36.6 0.5054
Lus10011218 39.3 0.4670

Lus10013783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.