Lus10013811 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09830 146 / 8e-43 Protein kinase superfamily protein (.1.2)
AT5G03320 137 / 1e-39 Protein kinase superfamily protein (.1)
AT2G28940 70 / 9e-15 Protein kinase superfamily protein (.1.2)
AT5G02290 66 / 2e-13 NAK Protein kinase superfamily protein (.1.2)
AT1G07570 63 / 2e-12 APK1A Protein kinase superfamily protein (.1.2.3)
AT1G14370 63 / 2e-12 Kin1, PBL2, APK2A PBS1-like 2, kinase 1, protein kinase 2A (.1)
AT1G69790 62 / 5e-12 Protein kinase superfamily protein (.1)
AT2G39110 62 / 6e-12 Protein kinase superfamily protein (.1)
AT5G15080 61 / 1e-11 Protein kinase superfamily protein (.1)
AT2G28930 61 / 1e-11 APK1B protein kinase 1B (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026523 254 / 2e-88 AT3G09830 151 / 6e-45 Protein kinase superfamily protein (.1.2)
Lus10038711 117 / 9e-32 AT3G09830 547 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10037980 110 / 5e-29 AT3G09830 544 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10016536 67 / 8e-14 AT2G28940 576 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10040804 62 / 7e-12 AT2G28940 578 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10030668 61 / 2e-11 AT5G15080 723 / 0.0 Protein kinase superfamily protein (.1)
Lus10005255 61 / 2e-11 AT5G15080 720 / 0.0 Protein kinase superfamily protein (.1)
Lus10021489 60 / 3e-11 AT2G02800 459 / 3e-161 protein kinase 2B (.1.2)
Lus10022591 60 / 3e-11 AT2G02800 462 / 2e-162 protein kinase 2B (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G126000 186 / 1e-57 AT3G09830 587 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G036800 132 / 9e-38 AT3G09830 537 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.010G225300 123 / 3e-34 AT2G39110 538 / 0.0 Protein kinase superfamily protein (.1)
Potri.009G031500 91 / 6e-22 AT2G28940 565 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G240500 90 / 1e-21 AT2G28940 563 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.014G052700 69 / 2e-14 AT5G47070 431 / 2e-149 Protein kinase superfamily protein (.1)
Potri.006G072200 66 / 3e-13 AT2G17220 391 / 2e-134 kinase 3, Protein kinase superfamily protein (.1.2)
Potri.010G203400 62 / 4e-12 AT2G28930 540 / 0.0 protein kinase 1B (.1.2.3)
Potri.008G056400 62 / 5e-12 AT1G07570 528 / 0.0 Protein kinase superfamily protein (.1.2.3)
Potri.008G148000 60 / 3e-11 AT2G02800 604 / 0.0 protein kinase 2B (.1.2)
PFAM info
Representative CDS sequence
>Lus10013811 pacid=23159436 polypeptide=Lus10013811 locus=Lus10013811.g ID=Lus10013811.BGIv1.0 annot-version=v1.0
ATGAAGTGCTTTCACTTCTATATCGGAGAAAGGAAGGATGATCTAAGGACAACAAAGTCTACATCAGTTACGTCGCTGTACTCGAATTTTACTGATCGTG
AAATGGGGAGATCGGGGTCTGAGTTGAATTCTCAAAATGTCTCAGCCACCAGTGTAGAATCAATGGGGAGGCCTAGCTACCCTATTCTGTCCCAGAGACC
AAGTAATCTGAGATCTTTCACTGTTTCCGAACTTAAGGCCGCCACCAGGAACTTCAGTCGCTCCTTCATGGTTGGAGAGGGCGGATTTGGATGCGTCTAC
AGAGGATCCATAAAGAGTGCAGAGGAGCCTCTCAAAAAAATTGAAGTCGCTGTGAAACAGCTTGGTAAAAGGGGAACTCAGGCAAGTCTTTCCCCTCTAG
GCAGTCCTCTATCTTCATTTAGTAGTTACTGA
AA sequence
>Lus10013811 pacid=23159436 polypeptide=Lus10013811 locus=Lus10013811.g ID=Lus10013811.BGIv1.0 annot-version=v1.0
MKCFHFYIGERKDDLRTTKSTSVTSLYSNFTDREMGRSGSELNSQNVSATSVESMGRPSYPILSQRPSNLRSFTVSELKAATRNFSRSFMVGEGGFGCVY
RGSIKSAEEPLKKIEVAVKQLGKRGTQASLSPLGSPLSSFSSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09830 Protein kinase superfamily pro... Lus10013811 0 1
AT5G58430 ATEXO70B1 exocyst subunit exo70 family p... Lus10011860 1.0 0.7781
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10027805 4.2 0.7483
AT5G47910 ATRBOHD, RBOHD respiratory burst oxidase homo... Lus10016740 5.3 0.7753
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10009035 11.3 0.7428
AT4G36190 Serine carboxypeptidase S28 fa... Lus10041817 17.4 0.7688
AT3G04240 SEC secret agent, Tetratricopeptid... Lus10003113 18.0 0.6961
AT1G54130 AT-RSH3, RSH3, ... RELA/SPOT homolog 3 (.1) Lus10015656 18.2 0.7065
AT4G03000 RING/U-box superfamily protein... Lus10041245 19.5 0.7579
AT5G53890 AtPSKR2 phytosylfokine-alpha receptor ... Lus10009213 20.1 0.7298
AT1G79710 Major facilitator superfamily ... Lus10024099 20.8 0.7304

Lus10013811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.