Lus10013813 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03330 280 / 3e-92 Cysteine proteinases superfamily protein (.1.2)
AT5G04250 236 / 1e-75 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 224 / 2e-72 Cysteine proteinases superfamily protein (.1)
AT3G22260 204 / 2e-64 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 96 / 2e-23 Cysteine proteinases superfamily protein (.1)
AT5G67170 67 / 4e-12 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 54 / 1e-07 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026525 647 / 0 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 383 / 5e-133 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 380 / 7e-132 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 257 / 3e-83 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10038708 254 / 4e-82 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 246 / 8e-80 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 202 / 7e-64 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 203 / 3e-63 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 172 / 6e-52 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094700 385 / 5e-134 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 370 / 5e-128 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 264 / 6e-86 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 263 / 2e-85 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.016G019700 225 / 1e-72 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 224 / 1e-72 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.008G036900 212 / 2e-68 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.006G021700 211 / 2e-67 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.005G140500 70 / 5e-13 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 51 / 7e-07 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10013813 pacid=23159415 polypeptide=Lus10013813 locus=Lus10013813.g ID=Lus10013813.BGIv1.0 annot-version=v1.0
ATGGCGGCGGCTCGCGATCACGATTCCGAATCGGATGTAATCCGGTGGGGGATGAGCCTTCTGGAAGTGGACCCGCCCTTTTATCCCGGCTACTACGGCG
GCGAAACAATTCAAAACGACCATGCCTATCATCACCTTCCTCGCCATGATGATTACGAAGCTGAAGACAACGACGAAATCATAGCTCGTACACTTCAGGA
GGATTTCTCCCAGCTCGCTCCCAGAGACTCTTCAAGGTATTCCCGTGAACAAGAAGCGGAAGACTACTCCCGTCCGTCCTATTACGGCGACAGCGACTGG
CCTACTACCTCGACGAGTTACGATTCGTTTGATCACGATCGTCGCAATGAGGATTCTGATGATACGGTTTCCTCTTGCTTATGTTCAAGCCCTAGCAATG
GGGAGCGACGGAAATTGTATCCTTCCGGATTAGCGGGTGATTATCGATTGGATGGTGAAGTAGGCAAAAGGTTGAATGAGTTTATACCCATTCGTCATGT
TCCTAAGATGAATGGAGAAATACCTTCATTTGATGAAGTAGCATCAGACCATGAGAGGCTTCTGAATAGATTGGAGGCATTTGGTTTTGCTGAGGTCAAG
GTTCAAGGGGATGGGAACTGTCAGGTTTTTCGAGCATTATCAGATCAATTATATGGAACTCCAGAAAGCCACAAAACTGTTAGAAAAGAGATTGTAAAAC
AGCTAAAATCCAACCCTGAGATGTATGAAGGATATGTTCCCATGAAGTATCGTGAATACTTGAGCAACATGTCCAGATCTGGTGAATGGGGTGACCACGT
CACATTGCAGGCAGCAGCTGATTCGTATGCCGTGAAAATACTCGTCATAACTTCATTCAAGGAGACTTCCTCCATAGAGATTGTCCCACGAAAGAAGAAG
CCACAGAGAGTCATCTTCTTGAGTTTCTGGGCGGAGGTACATTACAATGCAATCTGTTTCCGCAATAGAGACACAGCGGGGTCGGAACCTGATAAGAAGA
CGAAGAAGAAACGAAGGTGGATATTTGGCAAGAAACACTGA
AA sequence
>Lus10013813 pacid=23159415 polypeptide=Lus10013813 locus=Lus10013813.g ID=Lus10013813.BGIv1.0 annot-version=v1.0
MAAARDHDSESDVIRWGMSLLEVDPPFYPGYYGGETIQNDHAYHHLPRHDDYEAEDNDEIIARTLQEDFSQLAPRDSSRYSREQEAEDYSRPSYYGDSDW
PTTSTSYDSFDHDRRNEDSDDTVSSCLCSSPSNGERRKLYPSGLAGDYRLDGEVGKRLNEFIPIRHVPKMNGEIPSFDEVASDHERLLNRLEAFGFAEVK
VQGDGNCQVFRALSDQLYGTPESHKTVRKEIVKQLKSNPEMYEGYVPMKYREYLSNMSRSGEWGDHVTLQAAADSYAVKILVITSFKETSSIEIVPRKKK
PQRVIFLSFWAEVHYNAICFRNRDTAGSEPDKKTKKKRRWIFGKKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03330 Cysteine proteinases superfami... Lus10013813 0 1
AT1G19110 inter-alpha-trypsin inhibitor ... Lus10027666 4.6 0.7780
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10028639 5.3 0.8124
AT4G32850 PAP(IV), PAP(IV... poly\(A\) polymerase IV, poly\... Lus10005490 9.9 0.7537
AT4G38470 STY46 serine/threonine/tyrosine kina... Lus10005630 10.4 0.7471
AT1G60670 Protein of unknown function (D... Lus10013072 11.8 0.7960
AT4G36980 unknown protein Lus10019346 11.8 0.7738
AT5G02810 APRR7, PRR7 pseudo-response regulator 7 (.... Lus10014018 12.2 0.7324
AT5G57580 Calmodulin-binding protein (.1... Lus10018437 13.6 0.7761
AT1G09970 RLK7, LRRXI-23 ... receptor-like kinase 7, Leucin... Lus10028232 14.7 0.7292
AT3G07550 RNI-like superfamily protein (... Lus10041087 17.0 0.7260

Lus10013813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.