Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03345 127 / 1e-39 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026529 [exp] 112 / 1e-33 AT5G03345 129 / 1e-40 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G125300 [exp] 130 / 1e-40 AT5G03345 143 / 8e-46 unknown protein Potri.016G091900 [exp] 119 / 3e-36 AT5G03345 143 / 5e-46 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10270 [flax] [poplar] MMgT Membrane magnesium transporter
Representative CDS sequence Show only first row Show all	>Lus10013817 pacid=23159466 polypeptide=Lus10013817 locus=Lus10013817.g ID=Lus10013817.BGIv1.0 annot-version=v1.0 ATGGGATTGGGTTTTACAGTCGGCGTAATTGGAGTTCTAGTTCTCGGCCACGCCGTCTATTCAACTATTCAATATAGGGGATTGCTGAAGATCATGGAGG AGGAATTCTCGGGACCTCCAATGGATGTGGTGCTGGAGTTGCTCGTTGGACTATTGTTATGTTTGTGGGCTGCTTTAACTGTGCCAGGGAAGTTCCTTGC CATACATCCACATTCTGATGAAAACAGGGTTGTCTCTTTACCAGAGAATGTGGATTTCATGATCTTCAACCACAGGGGCAGGGTGTTGTCTTCTGAAATC GGCTTGAAACTCAAACTCTAG
AA sequence Show only first row Show all	>Lus10013817 pacid=23159466 polypeptide=Lus10013817 locus=Lus10013817.g ID=Lus10013817.BGIv1.0 annot-version=v1.0 MGLGFTVGVIGVLVLGHAVYSTIQYRGLLKIMEEEFSGPPMDVVLELLVGLLLCLWAALTVPGKFLAIHPHSDENRVVSLPENVDFMIFNHRGRVLSSEI GLKLKL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03345			unknown protein		Lus10013817 [exp]	0	1
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10007286 [exp]	2.0	0.9098
AT5G03345			unknown protein		Lus10026529 [exp]	3.2	0.8917
AT3G60540			Preprotein translocase Sec, Se...		Lus10037570 [exp]	6.2	0.8874
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10029155 [exp]	6.3	0.8649
AT3G51610		NPU	NO PRIMEXINE AND PLASMA MEMBRA...		Lus10006096 [exp]	7.7	0.8610
AT1G03330			Small nuclear ribonucleoprotei...		Lus10029641 [exp]	9.5	0.8730
AT1G64385			unknown protein		Lus10032376 [exp]	14.1	0.8863
AT5G53045			unknown protein		Lus10017942 [exp]	15.7	0.8607
AT3G25120			Mitochondrial import inner mem...		Lus10008094 [exp]	16.4	0.8615
AT4G32930			unknown protein		Lus10005503 [exp]	19.9	0.8624

Compare expression of checked genes

Lus10013817 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.