Lus10013819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 92 / 8e-25 SAUR-like auxin-responsive protein family (.1)
AT2G28085 60 / 2e-12 SAUR-like auxin-responsive protein family (.1)
AT4G38860 51 / 4e-09 SAUR-like auxin-responsive protein family (.1)
AT1G56150 50 / 7e-09 SAUR-like auxin-responsive protein family (.1)
AT1G76190 51 / 8e-09 SAUR-like auxin-responsive protein family (.1)
AT5G20810 51 / 8e-09 SAUR-like auxin-responsive protein family (.1.2)
AT3G60690 51 / 1e-08 SAUR-like auxin-responsive protein family (.1)
AT1G20470 50 / 1e-08 SAUR-like auxin-responsive protein family (.1)
AT2G46690 50 / 1e-08 SAUR-like auxin-responsive protein family (.1)
AT4G34770 49 / 2e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026531 264 / 1e-92 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10004014 214 / 6e-73 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10030263 206 / 7e-70 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10001398 140 / 2e-43 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1)
Lus10023012 137 / 2e-42 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001397 78 / 3e-19 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10021436 74 / 2e-17 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Lus10026532 73 / 2e-17 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10016129 73 / 5e-17 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G092400 131 / 2e-40 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 129 / 1e-39 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 85 / 5e-22 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 56 / 1e-10 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.005G237200 54 / 3e-10 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 55 / 5e-10 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.002G024300 53 / 7e-10 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 52 / 2e-09 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 52 / 3e-09 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 52 / 4e-09 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10013819 pacid=23159457 polypeptide=Lus10013819 locus=Lus10013819.g ID=Lus10013819.BGIv1.0 annot-version=v1.0
ATGACTATGTTCACCATCAACGACGACGAAAGCATCCGAGGGTTGATGCTGCTGAAGTTCTTCACAAGAAAGCTGCAAAGGACACTCATGATGATGACAT
CCAGATTAGGAGGGCAGAAGCTGCAGAAAACCAGCACTACTGGAGAGTATGAAGAAGACAAAGAAGGGATGAAGGAAGTTCCAAACGACGTTAAGAGAGG
GCAGTTTGCCGTGACAGCAACCAAAGGTGGGAAGCCAAAGAGGTTCATTGTTGAGTTGGATGACCTCAATGACCCTGATTTCCTCACCTTGCTCGAACTG
TCTGAGGACAAATTCGGGTTCGGCCAGGCAGGTGTGCTTGAGGTCCCTTGCTACCCTCTGGAGCTTCAGAAGGTTCTACGAGGTGGCAAAATCAGAAGAG
CAAGTGCTCAATGGTAG
AA sequence
>Lus10013819 pacid=23159457 polypeptide=Lus10013819 locus=Lus10013819.g ID=Lus10013819.BGIv1.0 annot-version=v1.0
MTMFTINDDESIRGLMLLKFFTRKLQRTLMMMTSRLGGQKLQKTSTTGEYEEDKEGMKEVPNDVKRGQFAVTATKGGKPKRFIVELDDLNDPDFLTLLEL
SEDKFGFGQAGVLEVPCYPLELQKVLRGGKIRRASAQW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10013819 0 1
AT3G57930 unknown protein Lus10031806 1.0 0.9399
AT5G64250 Aldolase-type TIM barrel famil... Lus10006545 1.7 0.9246
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10015883 3.7 0.9265
AT1G60060 Serine/threonine-protein kinas... Lus10018736 6.9 0.9205
AT1G03220 Eukaryotic aspartyl protease f... Lus10034035 8.9 0.9198
AT3G22250 UDP-Glycosyltransferase superf... Lus10035452 9.2 0.8626
AT1G45110 Tetrapyrrole (Corrin/Porphyrin... Lus10024288 10.5 0.8509
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Lus10003436 10.8 0.8505
AT2G27385 Pollen Ole e 1 allergen and ex... Lus10004847 11.0 0.9067
AT1G68260 Thioesterase superfamily prote... Lus10031948 11.8 0.9080

Lus10013819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.