Lus10013822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 429 / 9e-153 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 359 / 3e-125 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G10550 208 / 8e-66 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT1G32170 200 / 4e-62 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT4G14130 198 / 6e-62 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT1G14720 199 / 7e-62 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT5G57550 195 / 8e-61 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT2G01850 195 / 3e-60 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT3G23730 191 / 3e-59 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT3G25050 190 / 6e-59 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026535 536 / 0 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10001396 487 / 2e-175 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 482 / 1e-173 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 377 / 4e-132 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 372 / 4e-130 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10037377 372 / 4e-130 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 371 / 1e-129 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026536 358 / 3e-124 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013823 280 / 3e-95 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G122900 454 / 1e-162 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 446 / 2e-159 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G006600 374 / 6e-131 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.014G115000 211 / 9e-67 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.014G146100 202 / 1e-63 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.003G097300 202 / 7e-63 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.009G163850 199 / 1e-62 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.011G077320 198 / 7e-62 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.006G071200 196 / 2e-61 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.001G136100 197 / 6e-61 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10013822 pacid=23159481 polypeptide=Lus10013822 locus=Lus10013822.g ID=Lus10013822.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTTCCTCCCTCATTCTTCTTATTCTTTTGGCTCTTTCTTCATTCATCGCCATTGTTAATGCCCGGCCGCCCCGAACCGGGTTCCGACCCA
GCTTCAGGTTTAGATCATTCCCCTTCTACAAAGGGTATAATACCCTTTGGGGCCAGTCCCACCAAAGAGTGGACAGCAATGGAGTCACCATTTGGCTTGA
TAAAACTTCAGGAAGTGGGTTCAAGTCAGTGAAGCCATTTCGGTCTGGCTATTTCGGTGCCTCGGTCAAGCTCCAACCTGGCTACACTGCTGGAGTTAAC
ACTGCCTTCTATCTTTCAAACAGTGAAGCTCACCCAGGGAGCCATGATGAGGTGGACATTGAATTCCTTGGCAAGACATTCGACGAGCCTTACACTCTAC
AGACCAACGTTTACATTAGGGGAAGCGGGGATGGCAAAATCATTGGCAGAGAGATGAAGTTCCATTTATGGTTCGATCCCACCAAGAATTTCCACCACTA
TGCCATCATCTGGAATCCCAGAGAAATCATATTCCTAGTGGACGATGTGCCAATAAGGAGGTACCAAAAGAAAAGCGCCGCAACATTCCCAATGAGGCCC
ATGTGGGTATATGGCTCGATATGGGATGCCTCGGCTTGGGCTACTGACGATGGCAAGTACAAAGCCGATTATCGGTACCAACCCTTTGTCGCTAACATGA
AGAATTTCAAGGCCACAGGCTGCACCGCCTACTCGCCGAGGTGGTGCAGGGCGCCCACCGCCTCACCTGACCGGTCCGGTAAGCTAACGAGGCAGCAATA
CAATGCCATGAATTGGGTTCAAAAGTACCATATGGTGTACAATTATTGTTCGGACAAAGCAAGAGACCATTCGAAGACCCCCGAATGTTGGTTATGA
AA sequence
>Lus10013822 pacid=23159481 polypeptide=Lus10013822 locus=Lus10013822.g ID=Lus10013822.BGIv1.0 annot-version=v1.0
MASSSSLILLILLALSSFIAIVNARPPRTGFRPSFRFRSFPFYKGYNTLWGQSHQRVDSNGVTIWLDKTSGSGFKSVKPFRSGYFGASVKLQPGYTAGVN
TAFYLSNSEAHPGSHDEVDIEFLGKTFDEPYTLQTNVYIRGSGDGKIIGREMKFHLWFDPTKNFHHYAIIWNPREIIFLVDDVPIRRYQKKSAATFPMRP
MWVYGSIWDASAWATDDGKYKADYRYQPFVANMKNFKATGCTAYSPRWCRAPTASPDRSGKLTRQQYNAMNWVQKYHMVYNYCSDKARDHSKTPECWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10013822 0 1
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10026535 1.0 0.9316
AT1G05070 Protein of unknown function (D... Lus10035288 2.8 0.8151
AT3G54880 unknown protein Lus10013824 4.6 0.7552
AT1G70300 KUP6 K+ uptake permease 6, K+ uptak... Lus10030632 12.2 0.7415
AT2G20690 lumazine-binding family protei... Lus10017000 14.8 0.8019
Lus10019699 17.2 0.7246
Lus10012740 19.0 0.7756
AT5G03160 ATP58IPK homolog of mamallian P58IPK (.... Lus10015078 22.4 0.8095
AT5G56040 Leucine-rich receptor-like pro... Lus10042090 29.6 0.7543
AT4G24760 alpha/beta-Hydrolases superfam... Lus10042075 29.8 0.7454

Lus10013822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.