Lus10013823 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 261 / 6e-88 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 234 / 2e-77 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G10550 155 / 1e-46 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT1G32170 153 / 3e-45 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT2G01850 147 / 4e-43 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT3G25050 145 / 9e-43 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT1G14720 145 / 3e-42 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT4G18990 142 / 8e-41 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT4G14130 139 / 3e-40 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 137 / 9e-40 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026536 363 / 1e-127 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 265 / 3e-89 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10001396 264 / 5e-89 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 261 / 5e-88 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026535 261 / 1e-87 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 249 / 4e-83 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10037377 246 / 9e-82 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 240 / 9e-80 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 240 / 1e-79 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G122900 261 / 7e-88 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 255 / 9e-86 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G006600 239 / 2e-79 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.003G097300 161 / 2e-48 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.001G136100 160 / 5e-48 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.014G115000 149 / 5e-44 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.009G163850 147 / 1e-43 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.010G102300 146 / 1e-42 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.005G201200 145 / 1e-42 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 144 / 2e-42 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10013823 pacid=23159458 polypeptide=Lus10013823 locus=Lus10013823.g ID=Lus10013823.BGIv1.0 annot-version=v1.0
ATGCAGCTGTCGAATAATGAGGCTCATCCAGGGAATCATGATGAGGTGGACCTCGAGTTTCTGGGGAGGACACTGAAGGAGCCTTACACAGTGCAGACGA
ATGTGTACGTAAGGGGAAGTGGAGATGGAGGTGATATCATTGGGAGAGAAGCAAGGTTTCATTTGTGGTTTGATCCTACAAAACACTTCCACCATTATGC
CCTTCTTTGGAATCCTAAAGAGATCATATTTCTAGTGGACGACATTCCAATAAGAAGATACCAAAAGAAAAGTGATTCTACATTTCCAACAAGGCCAATG
TGGGTTTACGGCTCAATATGGGATGCCTCCGACTGGGCCACGGACGACGGAAAATACAGAGCAAATTACAAATACCAACCTTTTGTTTCAAAGTACAGGA
GATTCGTGACATCCGGTTGCCCCAACGATGCTCCGCCGAGTTGCCCGCCGGTATCGGCATCGCCTCATCGTTCCGGCGGGCTGACGGTGCGGCAGATCAC
GGCAATGAGATGGGTGCAGAAACACCGAATGGTGTATCACTATTGCATGGACACAACAAGGGACCATTCCCTCACCCCAGAGTGCAAGAAATTTGTGACA
AAGATGCGTAAAAATGGTCCACCGATTGGATAG
AA sequence
>Lus10013823 pacid=23159458 polypeptide=Lus10013823 locus=Lus10013823.g ID=Lus10013823.BGIv1.0 annot-version=v1.0
MQLSNNEAHPGNHDEVDLEFLGRTLKEPYTVQTNVYVRGSGDGGDIIGREARFHLWFDPTKHFHHYALLWNPKEIIFLVDDIPIRRYQKKSDSTFPTRPM
WVYGSIWDASDWATDDGKYRANYKYQPFVSKYRRFVTSGCPNDAPPSCPPVSASPHRSGGLTVRQITAMRWVQKHRMVYHYCMDTTRDHSLTPECKKFVT
KMRKNGPPIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10013823 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 2.8 1.0000
AT2G38500 2-oxoglutarate (2OG) and Fe(II... Lus10006093 3.0 1.0000
Lus10002413 3.7 1.0000
AT4G13090 XTH2 xyloglucan endotransglucosylas... Lus10025919 4.9 1.0000
AT3G11180 2-oxoglutarate (2OG) and Fe(II... Lus10023602 5.0 1.0000
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10028908 6.9 1.0000
Lus10027374 7.9 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 8.0 1.0000
Lus10033373 8.1 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10029383 8.4 1.0000

Lus10013823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.