Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54880 108 / 8e-32 unknown protein AT5G03440 103 / 3e-30 unknown protein AT5G25360 88 / 3e-23 unknown protein AT3G15770 85 / 4e-22 unknown protein AT4G32342 85 / 4e-22 unknown protein AT1G15350 75 / 9e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026537 [exp] 143 / 6e-46 AT5G03440 97 / 5e-28 unknown protein Lus10002164 [exp] 77 / 1e-18 AT5G25360 174 / 3e-56 unknown protein Lus10038690 [exp] 69 / 4e-16 AT3G54880 81 / 1e-20 unknown protein Lus10037957 [exp] 66 / 1e-14 AT3G54880 73 / 1e-17 unknown protein Lus10005466 [exp] 64 / 1e-14 AT5G25360 99 / 6e-28 unknown protein Lus10030101 [exp] 60 / 4e-13 AT5G25360 79 / 2e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G034600 [exp] 111 / 4e-33 AT3G54880 120 / 8e-37 unknown protein Potri.010G227800 [exp] 109 / 2e-32 AT3G54880 123 / 7e-38 unknown protein Potri.006G254000 [exp] 100 / 1e-27 AT5G25360 197 / 3e-65 unknown protein Potri.018G027800 [exp] 99 / 7e-27 AT5G25360 182 / 1e-58 unknown protein Potri.001G192700 [exp] 92 / 6e-25 AT5G25360 169 / 1e-54 unknown protein Potri.006G068600 [exp] 87 / 8e-23 AT5G25360 194 / 9e-64 unknown protein Potri.018G130900 [exp] 75 / 6e-18 AT5G25360 140 / 8e-43 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013824 pacid=23159478 polypeptide=Lus10013824 locus=Lus10013824.g ID=Lus10013824.BGIv1.0 annot-version=v1.0 ATGGTCGGTGGTAATAGCATAATGGAAACCGGTGACAATAAGCTACATTTTCATCACAAGGACCAGTTAGTAGTGGATGCAGCAGATGATCCTATCAAAG AGAATCCTCCTGTTGGAATTGAGTTTGTTAACCATGCTGAGATTGCTTGGCATGAGACAAGGAAGCAGTGGGTTGGTGATTCCTCTCGGAGGTCAAAGAG AGCGCCCAGAGAAGAAATCATGAGTTGGTCATCGACATATGACGATTTGCTCTCTTCCCATGAACCTTTCCAGCAGCCAATACCTCTAGCTGAGATGGTG GACTTTTTAGTTGACATATGGCTGGAAGATGGCCTCTACGACTGA
AA sequence Show only first row Show all	>Lus10013824 pacid=23159478 polypeptide=Lus10013824 locus=Lus10013824.g ID=Lus10013824.BGIv1.0 annot-version=v1.0 MVGGNSIMETGDNKLHFHHKDQLVVDAADDPIKENPPVGIEFVNHAEIAWHETRKQWVGDSSRRSKRAPREEIMSWSSTYDDLLSSHEPFQQPIPLAEMV DFLVDIWLEDGLYD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G54880			unknown protein		Lus10013824 [exp]	0	1
AT4G04955		ATALN	allantoinase (.1)		Lus10025648 [exp]	3.7	0.7426
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10013822 [exp]	4.6	0.7552
AT2G40060		CLC2	clathrin light chain 2, Clathr...		Lus10040187 [exp]	6.9	0.7198
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10008522 [exp]	8.9	0.7052
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Lus10025967 [exp]	15.2	0.7225
					Lus10019699 [exp]	16.7	0.6762
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10021892 [exp]	18.2	0.6596
AT1G05070			Protein of unknown function (D...		Lus10035288 [exp]	18.3	0.7110
AT5G66430			S-adenosyl-L-methionine-depend...		Lus10036548 [exp]	24.5	0.6674
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10041243 [exp]	31.1	0.6433

Compare expression of checked genes

Lus10013824 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.