Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53220 172 / 2e-56 Thioredoxin superfamily protein (.1) AT3G08710 62 / 6e-13 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 61 / 1e-12 Thioredoxin superfamily protein (.1) AT1G45145 60 / 2e-12 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT4G32580 58 / 2e-11 Thioredoxin superfamily protein (.1) AT5G39950 57 / 3e-11 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT4G04950 57 / 2e-10 AtGRXS17 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) AT2G40790 54 / 6e-10 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT1G31020 54 / 8e-10 ATO2 thioredoxin O2 (.1) AT2G35010 54 / 1e-09 ATO1 thioredoxin O1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026540 [exp] 239 / 3e-82 AT3G53220 148 / 2e-46 Thioredoxin superfamily protein (.1) Lus10014186 [exp] 79 / 2e-19 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10022727 [exp] 77 / 8e-19 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10024293 [exp] 61 / 1e-12 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10031334 [exp] 63 / 2e-12 AT3G17880 456 / 3e-160 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Lus10005258 [exp] 60 / 2e-12 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10000802 [exp] 60 / 2e-12 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 58 / 1e-11 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 57 / 4e-11 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G123100 [exp] 189 / 2e-63 AT3G53220 192 / 2e-64 Thioredoxin superfamily protein (.1) Potri.016G138800 [exp] 76 / 1e-18 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.006G110100 [exp] 73 / 3e-17 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 62 / 4e-13 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.005G232700 [exp] 61 / 8e-13 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 62 / 2e-12 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 62 / 4e-12 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.004G031700 [exp] 58 / 9e-12 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.007G018000 [exp] 58 / 1e-11 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.017G076700 [exp] 58 / 2e-11 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10013827 pacid=23159493 polypeptide=Lus10013827 locus=Lus10013827.g ID=Lus10013827.BGIv1.0 annot-version=v1.0 ATGGATGTGACGGAGGGAGATGGCAAGAAAGCTCCGGAAGGTAGCGATATGGCAGCGAATCGCTACGGCAACTTGAGAAGAGCATCAACTGATGAAACCC ACCTCCAGATTCTACGCCACATCACTTCTTCCCGAGCTCCTGCCGTCATCAACTACGGCGCATCATGGTGCAGCTCCTGTAATCGGATACTCCCTGCATT TCTCCGACTGAGCAACGACTTTCCCAAGCTTTCCTTCGTCTATGCAGATATCGACGAGTGCCCTGAAACAACCCACCACATTCGGTTCACCCCCTCTTTC CATTTTTACCGCGACGGAGAAAAGGTTGATGAGATGATCGGCGTCGGAGATGAGCGGCTCCATGACCGCTTGTGGGTACATTCTGATTGA
AA sequence Show only first row Show all	>Lus10013827 pacid=23159493 polypeptide=Lus10013827 locus=Lus10013827.g ID=Lus10013827.BGIv1.0 annot-version=v1.0 MDVTEGDGKKAPEGSDMAANRYGNLRRASTDETHLQILRHITSSRAPAVINYGASWCSSCNRILPAFLRLSNDFPKLSFVYADIDECPETTHHIRFTPSF HFYRDGEKVDEMIGVGDERLHDRLWVHSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53220			Thioredoxin superfamily protei...		Lus10013827 [exp]	0	1
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	1.7	0.8396
AT4G16510			YbaK/aminoacyl-tRNA synthetase...		Lus10008505 [exp]	4.7	0.8308
AT5G36950		DEGP10	DegP protease 10 (.1)		Lus10008727 [exp]	12.4	0.8152
AT1G60400			F-box/RNI-like superfamily pro...		Lus10023039 [exp]	13.3	0.7826
AT2G39910			ARM repeat superfamily protein...		Lus10040233 [exp]	16.2	0.7648
AT2G35736			unknown protein		Lus10028935 [exp]	16.4	0.8143
AT3G54630			unknown protein		Lus10030584 [exp]	17.4	0.7249
AT1G28100			unknown protein		Lus10002573 [exp]	19.7	0.7918
AT1G69450			Early-responsive to dehydratio...		Lus10036791 [exp]	21.9	0.7753
AT2G37680		PAT3, FRY1, FHY...	unknown protein		Lus10023781 [exp]	23.0	0.7955

Compare expression of checked genes

Lus10013827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.