Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35320 92 / 4e-25 unknown protein AT2G17300 59 / 2e-12 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026561 [exp] 173 / 3e-57 AT4G35320 117 / 2e-34 unknown protein Lus10001621 [exp] 121 / 8e-37 AT4G35320 102 / 1e-28 unknown protein Lus10022985 [exp] 117 / 1e-34 AT4G35320 105 / 3e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G207500 [exp] 125 / 2e-38 AT4G35320 110 / 1e-31 unknown protein Potri.009G168800 [exp] 113 / 1e-33 AT4G35320 113 / 1e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013844 pacid=23159444 polypeptide=Lus10013844 locus=Lus10013844.g ID=Lus10013844.BGIv1.0 annot-version=v1.0 ATGGGACAAAACGCCGGCGACTCCATCAAGAGCTGGTGGGAGTGGGGTTTGGGCTGGATCCTGTCCAAGAAGCCGGTGTTCGCCCAAGATCTGGAGATGA ACGAGGAGGAGAAGAAGCTGCTCGGCTCCAGCAACAGGGGGAGCTGGAGACACATTGTGTACAAGGTTAGGTCAAGGATCAGGATCGTCAGATCTGATAA AGTCGGACTCCCCCAGACTTGCAGGTACGATTCTTACCACTACGCCCGCAATTTCGACTACTCCAAGTGA
AA sequence Show only first row Show all	>Lus10013844 pacid=23159444 polypeptide=Lus10013844 locus=Lus10013844.g ID=Lus10013844.BGIv1.0 annot-version=v1.0 MGQNAGDSIKSWWEWGLGWILSKKPVFAQDLEMNEEEKKLLGSSNRGSWRHIVYKVRSRIRIVRSDKVGLPQTCRYDSYHYARNFDYSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35320			unknown protein		Lus10013844 [exp]	0	1
AT2G16595			Translocon-associated protein ...		Lus10026282 [exp]	1.4	0.8821
AT1G79750		ATNADP-ME4	Arabidopsis thaliana NADP-mali...		Lus10025823 [exp]	2.0	0.8640
AT2G18950		ATHPT, VTE2, TP...	VITAMIN E 2, homogentisate phy...		Lus10006961 [exp]	3.0	0.8472
AT4G31050			Biotin/lipoate A/B protein lig...		Lus10025664 [exp]	6.5	0.7995
AT3G18050			unknown protein		Lus10038961 [exp]	9.0	0.7921
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Lus10039895 [exp]	11.3	0.8303
AT3G07210			unknown protein		Lus10038194 [exp]	13.0	0.8028
AT1G53300		TTL1	tetratricopetide-repeat thiore...		Lus10028154 [exp]	13.4	0.8187
AT2G25220			Protein kinase superfamily pro...		Lus10005345 [exp]	13.6	0.7971
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10030628 [exp]	17.3	0.7490

Compare expression of checked genes

Lus10013844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.