Lus10013854 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38160 446 / 3e-158 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT1G78930 131 / 4e-34 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 118 / 2e-29 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT2G44020 115 / 1e-28 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 112 / 1e-27 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
AT5G55580 107 / 1e-25 Mitochondrial transcription termination factor family protein (.1)
AT3G18870 99 / 6e-24 Mitochondrial transcription termination factor family protein (.1)
AT4G14605 98 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
AT5G54180 82 / 3e-17 PTAC15 plastid transcriptionally active 15 (.1)
AT2G36000 78 / 3e-16 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026571 397 / 6e-140 AT4G38160 252 / 4e-83 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Lus10035714 136 / 6e-36 AT1G78930 582 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10014877 128 / 4e-33 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10035227 125 / 6e-32 AT4G14605 518 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10032061 123 / 2e-31 AT4G14605 521 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10003775 122 / 6e-31 AT5G55580 546 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10022321 119 / 5e-30 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10004614 117 / 3e-29 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10042322 117 / 7e-29 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G209400 526 / 0 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.009G170300 518 / 0 AT4G38160 479 / 8e-170 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.007G001800 137 / 5e-36 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 120 / 2e-30 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 119 / 1e-29 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.001G361800 115 / 2e-28 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.013G116700 114 / 4e-28 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.017G067600 103 / 1e-24 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.004G150600 98 / 2e-23 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1)
Potri.016G072200 83 / 9e-18 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10013854 pacid=23159448 polypeptide=Lus10013854 locus=Lus10013854.g ID=Lus10013854.BGIv1.0 annot-version=v1.0
ATGGCGTGTAATCAAAACCCTACCAGCGTGATGTGGTTCTTTCGGGACAGAGGCTTCGACGAGAAAAGCATCAACGACATGTTCACAAAGTGCAAGCGTC
TTGAAGGTGCTCACAAGGATAGAGCATCTGAGAATTGGGATTTCTTGAAAAGCATTGGCATTCAAGAAAGGAAGCTCCCTTCCATAATCTCCAAGTGCCC
CAAACTCCTAACCCTCGGCCTCCACGAGAGGCTCGTCCCTATGGTGGAGTGTCTCGCCACGCTCGGTACGAAACCACGCGAGGTTGCATCGACAATCACC
AAGTTCCCTCACATACTCTCTCATAGCGTTCAAGAGAAGCTATGCCCTCTATTGGCATTCTTTCAAGCACTGGGGATTTCTGATAAACAAGTTGGGAAGC
TGATAATGCTCAATCCTAGGCTGGTTAGCTACAGCATTGATACCAAGATGAAAGAGCTTGTTGACTTCCTTGTTGGTTTGGGGCTCACCAGAGATGGAAT
GATCGGTAGAGTTCTTGTGAAGCACCCTTTCATATTGGGGTACAATATAGAGAAAAGGCTGCGGCCAACCTGCGAGTTCTTAAGATCGGTTGGCCTCTCA
GCTTCTGATCTTCAGACTGTTGTTTTGAAGTTCCCTGATGTTGTGTGTAGAGATGTGGAGAAGACTTTGAAACCGAATTTTGCTTATCTGAGGGGATGTG
GGTTTGGAGATGGACAGTTGGTTGCTTTGGTGACTGGTTACCCTCCCATTCTGATCAAGAGCATCCAGAATTCTTTAGAACCTAGGATGAAGTTCTTGGT
TGATGTTATGGGGAGACAGCTTGATGAAGTTGTGGAGTACCCTAACTTCTTCCAGTGTGGGTTGAAGAAGACGCTGGAGTCGAGGCACAGATTTTTGAGG
CAGAGGAATGTAGAATGTAGCTTGAGCGATATGTTGAGCTGTAATCATAAGAAGTTCTTCATGAAATATGGGTCCGGTTGA
AA sequence
>Lus10013854 pacid=23159448 polypeptide=Lus10013854 locus=Lus10013854.g ID=Lus10013854.BGIv1.0 annot-version=v1.0
MACNQNPTSVMWFFRDRGFDEKSINDMFTKCKRLEGAHKDRASENWDFLKSIGIQERKLPSIISKCPKLLTLGLHERLVPMVECLATLGTKPREVASTIT
KFPHILSHSVQEKLCPLLAFFQALGISDKQVGKLIMLNPRLVSYSIDTKMKELVDFLVGLGLTRDGMIGRVLVKHPFILGYNIEKRLRPTCEFLRSVGLS
ASDLQTVVLKFPDVVCRDVEKTLKPNFAYLRGCGFGDGQLVALVTGYPPILIKSIQNSLEPRMKFLVDVMGRQLDEVVEYPNFFQCGLKKTLESRHRFLR
QRNVECSLSDMLSCNHKKFFMKYGSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10013854 0 1
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Lus10037629 2.0 0.9746
AT3G63190 HFP108, AtcpRRF... "ribosome recycling factor, ch... Lus10022041 2.6 0.9679
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Lus10043055 2.6 0.9753
AT5G44600 S-adenosyl-L-methionine-depend... Lus10038404 6.3 0.9640
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10041940 6.9 0.9704
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10041469 6.9 0.9664
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10001861 7.1 0.9692
AT5G54600 Translation protein SH3-like f... Lus10005180 7.7 0.9699
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10034302 8.1 0.9683
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 9.2 0.9592

Lus10013854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.