Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38170 91 / 7e-23 FRS9 FAR1-related sequence 9 (.1) AT4G38180 70 / 2e-15 FAR1_related FRS5 FAR1-related sequence 5 (.1) AT4G12850 45 / 8e-07 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G209100 [exp] 99 / 1e-25 AT4G38170 716 / 0.0 FAR1-related sequence 9 (.1) Potri.011G145800 [exp] 80 / 7e-19 AT4G38180 1003 / 0.0 FAR1-related sequence 5 (.1) Potri.004G209000 [exp] 72 / 6e-16 AT4G38180 1163 / 0.0 FAR1-related sequence 5 (.1) Potri.005G257600 [exp] 71 / 9e-16 AT4G38180 891 / 0.0 FAR1-related sequence 5 (.1) Potri.009G170100 [exp] 70 / 2e-15 AT4G38180 1145 / 0.0 FAR1-related sequence 5 (.1) Potri.007G128700 [exp] 40 / 9e-05 AT3G07500 138 / 2e-40 Far-red impaired responsive (FAR1) family protein (.1) Potri.014G176500 [exp] 38 / 0.0004 AT3G07500 275 / 2e-94 Far-red impaired responsive (FAR1) family protein (.1) Potri.002G239400 [exp] 37 / 0.0007 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.017G029400 [exp] 37 / 0.0007 AT2G43280 319 / 4e-112 Far-red impaired responsive (FAR1) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013855 pacid=23159442 polypeptide=Lus10013855 locus=Lus10013855.g ID=Lus10013855.BGIv1.0 annot-version=v1.0 ATGGAAGCATTGCAAGAGGCTGCCAAGAAGATTTACGCTGGTAAAAGTAAAGATTCCAGTCTACCTTCAGCCAATGGAGGAGGTGATCCAGCCATGCACC CAGCTGGAGAAGAAGGATCAGCAGCACCTGAATCAGTGGAAGACAGGGAGAGGAAGATTCAAGAGCTGGCGATGGAGTTGGAGAAGATTAACGAAAGAAG TGAAGTATACAGAAGCAACTTGGTAGCAGTTTTGAGAGATATGGAAGAGCAAAAACTGAAGTTGTCACTAAAGGTGCAAAATGCACGCTTAAGTATGAAA GAATGA
AA sequence Show only first row Show all	>Lus10013855 pacid=23159442 polypeptide=Lus10013855 locus=Lus10013855.g ID=Lus10013855.BGIv1.0 annot-version=v1.0 MEALQEAAKKIYAGKSKDSSLPSANGGGDPAMHPAGEEGSAAPESVEDRERKIQELAMELEKINERSEVYRSNLVAVLRDMEEQKLKLSLKVQNARLSMK E

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38170		FRS9	FAR1-related sequence 9 (.1)		Lus10013855 [exp]	0	1
AT3G23360			Protein phosphatase 2C family ...		Lus10011808 [exp]	4.4	0.8583
AT5G61970			signal recognition particle-re...		Lus10032538 [exp]	7.2	0.8889
AT1G79915			Putative methyltransferase fam...		Lus10035886 [exp]	10.2	0.8812
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10015000 [exp]	11.2	0.8845
AT3G22660			rRNA processing protein-relate...		Lus10037050 [exp]	13.2	0.8763
AT1G56440		TPR5	tetratricopeptide repeat 5, Te...		Lus10010915 [exp]	15.9	0.8592
AT4G28360			Ribosomal protein L22p/L17e fa...		Lus10006865 [exp]	20.0	0.8874
AT5G26800			unknown protein		Lus10011180 [exp]	20.3	0.8726
AT4G28360			Ribosomal protein L22p/L17e fa...		Lus10037603 [exp]	21.4	0.8764
AT1G07170			PHF5-like protein (.1.2.3)		Lus10040654 [exp]	23.1	0.8414

Compare expression of checked genes

Lus10013855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.