Lus10013862 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 154 / 7e-47 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 140 / 1e-41 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026578 381 / 7e-136 AT2G15220 209 / 7e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026577 356 / 4e-126 AT2G15220 202 / 4e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10013861 339 / 1e-119 AT2G15220 209 / 3e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026576 219 / 6e-72 AT2G15220 186 / 2e-58 Plant basic secretory protein (BSP) family protein (.1)
Lus10013860 176 / 7e-56 AT2G15220 148 / 4e-45 Plant basic secretory protein (BSP) family protein (.1)
Lus10013868 177 / 1e-55 AT2G15220 217 / 3e-71 Plant basic secretory protein (BSP) family protein (.1)
Lus10026585 175 / 7e-55 AT2G15220 207 / 2e-67 Plant basic secretory protein (BSP) family protein (.1)
Lus10013869 166 / 3e-51 AT2G15220 209 / 5e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026586 166 / 5e-51 AT2G15220 204 / 8e-66 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 166 / 2e-51 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 165 / 4e-51 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 159 / 1e-48 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 153 / 2e-46 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 138 / 2e-40 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10013862 pacid=23159437 polypeptide=Lus10013862 locus=Lus10013862.g ID=Lus10013862.BGIv1.0 annot-version=v1.0
ATGTTAGTTCTTGTAATAGTACTGCTGTTCGCAGATTTAGGATCATCAGGAGCAACGGTTCCGTTGCAGATCATTGAGTACTCGGTTACAAACAACGCCC
TCAACACAGCGGGAGGACTCCAATTCGAGGAGGTGATCGGGGAAGTCTACGCCAAGAATGCAATGGTGAAAGCCACCTACTTCGCGTGGCGAGTGTTCAA
CCAGCTTGCCGTCCCTGAACGCAGAAAATCGGTCCAGAAGATTGACCTGGTGGTTGACCAGTTCAGCGTTGATAATACTAATACTCGCTTTCTGGCCTAC
ATAGTCAACGGCTCGTCCATTCACATCGACGCCAGCTACTTGGAAACCTACAAAGGAGATCTTAAGACCGAATTTACAGGGATCTTGTACAACCAAGTGG
CGAGCATTCTGGAATGGAACGGGAACGGCGAGGCTCCGGCGGGGCTAACATCAGGAATGGCCGATTATGTGAGGATGAAGGCTGGATACTGTAACAAGCT
CAAGAGAGGGTTCGTTGCGGAGCTCAACGCCAGGATGAAGAACGGTTATACTGTTGGCTATTTCGTGGACATCCTCGGCAATAATGTCGAACAGCTTTGG
TCCGACTACAAAACCATGTACGCCGCCGACGAGCATTAG
AA sequence
>Lus10013862 pacid=23159437 polypeptide=Lus10013862 locus=Lus10013862.g ID=Lus10013862.BGIv1.0 annot-version=v1.0
MLVLVIVLLFADLGSSGATVPLQIIEYSVTNNALNTAGGLQFEEVIGEVYAKNAMVKATYFAWRVFNQLAVPERRKSVQKIDLVVDQFSVDNTNTRFLAY
IVNGSSIHIDASYLETYKGDLKTEFTGILYNQVASILEWNGNGEAPAGLTSGMADYVRMKAGYCNKLKRGFVAELNARMKNGYTVGYFVDILGNNVEQLW
SDYKTMYAADEH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10013862 0 1

Lus10013862 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.