Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15130 45 / 2e-07 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2) AT2G15220 39 / 6e-05 Plant basic secretory protein (BSP) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026580 [exp] 79 / 2e-20 AT2G15220 117 / 4e-33 Plant basic secretory protein (BSP) family protein (.1) Lus10013863 [exp] 55 / 2e-10 AT2G15220 224 / 9e-74 Plant basic secretory protein (BSP) family protein (.1) Lus10026579 [exp] 54 / 2e-10 AT2G15220 226 / 1e-74 Plant basic secretory protein (BSP) family protein (.1) Lus10019799 [exp] 51 / 4e-09 AT2G15220 199 / 2e-64 Plant basic secretory protein (BSP) family protein (.1) Lus10014106 [exp] 47 / 1e-07 AT2G15220 230 / 2e-76 Plant basic secretory protein (BSP) family protein (.1) Lus10014111 [exp] 47 / 1e-07 AT2G15220 202 / 3e-65 Plant basic secretory protein (BSP) family protein (.1) Lus10019807 [exp] 47 / 1e-07 AT2G15220 229 / 5e-76 Plant basic secretory protein (BSP) family protein (.1) Lus10019803 [exp] 44 / 8e-07 AT2G15220 231 / 4e-77 Plant basic secretory protein (BSP) family protein (.1) Lus10019805 [exp] 44 / 2e-06 AT2G15220 213 / 8e-70 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G094500 [exp] 47 / 6e-08 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1) Potri.009G094600 [exp] 47 / 7e-08 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1) Potri.001G299600 [exp] 45 / 3e-07 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1) Potri.001G299500 [exp] 43 / 3e-06 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1) Potri.001G299400 [exp] 41 / 1e-05 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [flax] [poplar] Peptidase_MA PF04450 [flax] [poplar] BSP Peptidase of plants and bacteria
Representative CDS sequence Show only first row Show all	>Lus10013864 pacid=23159425 polypeptide=Lus10013864 locus=Lus10013864.g ID=Lus10013864.BGIv1.0 annot-version=v1.0 ATGGACAGGGAGCGGGCGAGCGTGTGGCAGTGGACGGGTGGCGGGTCGGGGCAGGCTAACGTAGGGTTGCTCGACGGGATAGCCAACTACGTGAGGATGA AGGCGGACCTTGTTGCCGAGAGCGGCTGGGTGAAGCCCGGTGGTGCCCGGAGGAGGGGACAGGTGGGACCAAGGTGGGGACGTGACGGCGAGGTTTCTGG AGTACTGTGA
AA sequence Show only first row Show all	>Lus10013864 pacid=23159425 polypeptide=Lus10013864 locus=Lus10013864.g ID=Lus10013864.BGIv1.0 annot-version=v1.0 MDRERASVWQWTGGGSGQANVGLLDGIANYVRMKADLVAESGWVKPGGARRRGQVGPRWGRDGEVSGVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15130			Plant basic secretory protein ...		Lus10013864 [exp]	0	1
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	12.6	0.7864
AT3G28030		UVR1, UVH3	UV REPAIR DEFECTIVE 1, ULTRAVI...		Lus10039482 [exp]	13.0	0.7009
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	17.9	0.7814
AT5G14090			unknown protein		Lus10037042 [exp]	22.7	0.7798
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10016227 [exp]	32.4	0.7238
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10020556 [exp]	32.5	0.7702
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	36.5	0.7578
AT2G19330		PIRL6	plant intracellular ras group-...		Lus10035622 [exp]	38.2	0.6631
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10032973 [exp]	38.6	0.7124
AT2G01520		ZCE1, MLP328	\(Zusammen-CA\)-enhanced 1, ML...		Lus10028887 [exp]	46.9	0.7182

Compare expression of checked genes

Lus10013864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.