Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19508 132 / 3e-42 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G094200 [exp] 124 / 3e-39 AT3G19508 129 / 7e-41 unknown protein Potri.001G299200 [exp] 124 / 5e-39 AT3G19508 129 / 6e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013875 pacid=23159484 polypeptide=Lus10013875 locus=Lus10013875.g ID=Lus10013875.BGIv1.0 annot-version=v1.0 ATGCGGAAGGCATTGAGAATCTACGGCGAGGTTCTCAGGCTAGTAAGGCGGCTGCCCAAGGACTCCAGGCTATACTATGCCAAATACGCCCGTGAAAACT TCGTCAACTATCGGGAATTAGACGAAGACACGTCGCTCGATGAGCTCTTCCGTCGATCTTACAACCATTCCCTCTGGGTCCTCAGCAAGTACTCGGTGGA CGAATCGGCAGCTATGAAGCTGAAGGATATTTGTTTTGAGTGA
AA sequence Show only first row Show all	>Lus10013875 pacid=23159484 polypeptide=Lus10013875 locus=Lus10013875.g ID=Lus10013875.BGIv1.0 annot-version=v1.0 MRKALRIYGEVLRLVRRLPKDSRLYYAKYARENFVNYRELDEDTSLDELFRRSYNHSLWVLSKYSVDESAAMKLKDICFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19508			unknown protein		Lus10013875 [exp]	0	1
AT3G52170			DNA binding (.1.2)		Lus10028828 [exp]	1.0	0.8332
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10015146 [exp]	6.6	0.7605
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10026218 [exp]	8.0	0.7218
AT1G16040			unknown protein		Lus10032921 [exp]	9.5	0.7007
AT5G48030		GFA2	gametophytic factor 2 (.1)		Lus10011934 [exp]	10.7	0.7783
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	10.8	0.7639
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10040106 [exp]	11.0	0.7586
AT5G23260	MADS	ABS, TT16, AGL3...	TRANSPARENT TESTA16, AGAMOUS-l...		Lus10017388 [exp]	11.8	0.7504
AT5G56940			Ribosomal protein S16 family p...		Lus10014281 [exp]	14.3	0.7196
AT3G13860		HSP60-3A	heat shock protein 60-3A (.1)		Lus10003791 [exp]	14.4	0.7394

Compare expression of checked genes

Lus10013875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.