Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G107000 [exp] 85 / 4e-20 AT4G03500 140 / 5e-35 Ankyrin repeat family protein (.1) Potri.019G108501 [exp] 81 / 2e-19 AT4G03500 87 / 4e-19 Ankyrin repeat family protein (.1) Potri.019G108000 [exp] 82 / 3e-19 AT4G03500 126 / 3e-30 Ankyrin repeat family protein (.1) Potri.019G108200 [exp] 82 / 4e-19 AT4G03500 114 / 2e-26 Ankyrin repeat family protein (.1) Potri.019G107400 [exp] 78 / 1e-18 AT4G03500 72 / 2e-14 Ankyrin repeat family protein (.1) Potri.019G106000 [exp] 78 / 8e-18 AT4G03460 109 / 8e-25 Ankyrin repeat family protein (.1) Potri.019G108801 [exp] 78 / 8e-18 AT4G03500 101 / 4e-23 Ankyrin repeat family protein (.1) Potri.019G109150 [exp] 77 / 3e-17 AT4G03500 83 / 1e-16 Ankyrin repeat family protein (.1) Potri.019G107700 [exp] 73 / 7e-16 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1) Potri.019G105900 [exp] 71 / 4e-15 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013877 pacid=23159432 polypeptide=Lus10013877 locus=Lus10013877.g ID=Lus10013877.BGIv1.0 annot-version=v1.0 ATGGATTCCGCAAGTATTCCTGATGCCCACCGATCAGGAAGAAAAGAGTTCTTATCATTCATGGATGGAGATTTGTATAAAGCTGCAGCCCAAGGCAAAT TGGATGGTTTAATTAATCGCGGCGAGCTTCTGAATCAACTGCTGACCCCAAACAAGAACACAGTTCTGCATGTTTACCTTTCTGCACCTGGACAAGCAAA ATCCGGAAAAGATTCTGTATTTTTGGGGAAAGTCCTTGACGTGTTTCTGCTTCAGATCAATGCCACGAATGACTCTCTGCTACACTTTGCAGCAAGATAT GGTCATGAGTATGCAGTGAAAGTTCTCATCAGTCGGGCAGAGGTCATGGATTTGCAGATTTGGAAGGCGGTGGTGTAG
AA sequence Show only first row Show all	>Lus10013877 pacid=23159432 polypeptide=Lus10013877 locus=Lus10013877.g ID=Lus10013877.BGIv1.0 annot-version=v1.0 MDSASIPDAHRSGRKEFLSFMDGDLYKAAAQGKLDGLINRGELLNQLLTPNKNTVLHVYLSAPGQAKSGKDSVFLGKVLDVFLLQINATNDSLLHFAARY GHEYAVKVLISRAEVMDLQIWKAVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013877 [exp]	0	1
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10031808 [exp]	5.7	0.8119
					Lus10022108 [exp]	9.8	0.7197
AT2G36780			UDP-Glycosyltransferase superf...		Lus10023893 [exp]	12.0	0.7197
					Lus10003272 [exp]	13.9	0.7197
					Lus10012326 [exp]	14.5	0.6127
AT3G47090			Leucine-rich repeat protein ki...		Lus10028479 [exp]	15.5	0.7197
					Lus10030783 [exp]	17.0	0.7197
					Lus10010826 [exp]	18.3	0.7197
					Lus10036152 [exp]	19.6	0.7197
					Lus10037861 [exp]	20.8	0.7197

Compare expression of checked genes

Lus10013877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.