Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25580 255 / 7e-88 Thioredoxin superfamily protein (.1) AT2G18990 255 / 9e-88 TXND9 thioredoxin domain-containing protein 9 homolog (.1) AT5G66410 114 / 6e-32 PLP3B phosducin-like protein 3 homolog (.1) AT3G50960 113 / 1e-31 PLP3A phosducin-like protein 3 homolog (.1) AT5G39950 43 / 9e-06 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT5G42980 41 / 4e-05 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT3G17880 42 / 6e-05 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G03680 40 / 0.0002 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 39 / 0.0005 ATHM2 Thioredoxin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026602 [exp] 220 / 4e-75 AT3G25580 168 / 3e-54 Thioredoxin superfamily protein (.1) Lus10025176 [exp] 121 / 7e-35 AT5G66410 362 / 1e-128 phosducin-like protein 3 homolog (.1) Lus10016055 [exp] 119 / 4e-34 AT5G66410 357 / 2e-126 phosducin-like protein 3 homolog (.1) Lus10036695 [exp] 45 / 4e-06 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10005258 [exp] 44 / 8e-06 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037227 [exp] 44 / 1e-05 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10037228 [exp] 43 / 1e-05 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 43 / 2e-05 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10030666 [exp] 42 / 4e-05 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G092700 [exp] 255 / 7e-88 AT2G18990 290 / 2e-100 thioredoxin domain-containing protein 9 homolog (.1) Potri.001G297900 [exp] 251 / 6e-86 AT3G25580 286 / 3e-99 Thioredoxin superfamily protein (.1) Potri.007G020400 [exp] 115 / 2e-32 AT5G66410 297 / 8e-103 phosducin-like protein 3 homolog (.1) Potri.005G232700 [exp] 43 / 8e-06 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 44 / 1e-05 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.017G076700 [exp] 42 / 3e-05 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.019G111200 [exp] 42 / 6e-05 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.002G030000 [exp] 40 / 7e-05 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 40 / 0.0002 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.007G018000 [exp] 39 / 0.0002 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10013889 pacid=23159512 polypeptide=Lus10013889 locus=Lus10013889.g ID=Lus10013889.BGIv1.0 annot-version=v1.0 ATGGCCGAGAAGCGTAGGCGTTGGATCTCCCTCGGCCATGGCGATTACACCGAGATCCCCGCCGAGAAGGACTTCTTCTCCGTCGTCAAAGCCAGCGACC GCGTCGTTTGCCATTTCTATCGCGAGAATTGGCCTTGCAAGGTGGTGGACAAGCATCTTGCTATATTGGCGAAACAGCACATCGAGACTCGATTTGTGAA AATCAATGCCGAGAAAAGCCCCTTTTTGGCCGATAAACTCAAGATTGTGGTTCTTCCTACTCTTGCCCTCATTAAGAATGCCAAAGTCGATGACTACGTG GTTGGTTTTGATCAGCTTGGCGGGACTGATGATTTTAGCACCGAGGAATTAGAGGAGAGGCTGGGCAAAGCTAAAGTAATCTTCTACGAAGATGAATCAT CTGTGGCGAGGTCAAGCCACCAGACTAAGAGGAACGTCAGACAAAGCGAAACTCACGACTCCTCAGATTCCGAATGA
AA sequence Show only first row Show all	>Lus10013889 pacid=23159512 polypeptide=Lus10013889 locus=Lus10013889.g ID=Lus10013889.BGIv1.0 annot-version=v1.0 MAEKRRRWISLGHGDYTEIPAEKDFFSVVKASDRVVCHFYRENWPCKVVDKHLAILAKQHIETRFVKINAEKSPFLADKLKIVVLPTLALIKNAKVDDYV VGFDQLGGTDDFSTEELEERLGKAKVIFYEDESSVARSSHQTKRNVRQSETHDSSDSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25580			Thioredoxin superfamily protei...		Lus10013889 [exp]	0	1
AT3G63170			Chalcone-flavanone isomerase f...		Lus10022046 [exp]	2.4	0.8602
AT3G07480			2Fe-2S ferredoxin-like superfa...		Lus10009565 [exp]	2.4	0.8884
AT1G43690			ubiquitin interaction motif-co...		Lus10024546 [exp]	3.5	0.8891
AT2G21170		PDTPI, TIM	PLASTID ISOFORM TRIOSE PHOSPHA...		Lus10007575 [exp]	4.2	0.8744
AT4G14010		RALFL32	ralf-like 32 (.1)		Lus10023223 [exp]	4.7	0.8504
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041870 [exp]	5.5	0.8639
AT2G29900		PS2	Presenilin-2 (.1)		Lus10031966 [exp]	5.7	0.8573
AT4G37660			Ribosomal protein L12/ ATP-dep...		Lus10000093 [exp]	8.9	0.8373
AT1G79930		AtHsp70-14, HSP...	heat shock protein 91 (.1.2)		Lus10037529 [exp]	8.9	0.8655
AT5G15450		AtCLPB3, APG6, ...	CASEIN LYTIC PROTEINASE B-P, A...		Lus10030705 [exp]	9.2	0.8502

Compare expression of checked genes

Lus10013889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.