Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34140 148 / 9e-46 DOF AtDof2. 3 Dof-type zinc finger DNA-binding family protein (.1) AT1G29160 146 / 4e-45 DOF AtDof1. 5 Dof-type zinc finger DNA-binding family protein (.1) AT3G47500 120 / 1e-32 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) AT5G39660 119 / 4e-32 DOF CDF2, AtDof5. 2 cycling DOF factor 2 (.1.2) AT5G62430 114 / 2e-31 DOF CDF1, AtDof5,5 cycling DOF factor 1 (.1) AT1G69570 110 / 6e-29 DOF AtDof1,10 Dof-type zinc finger DNA-binding family protein (.1) AT1G26790 109 / 9e-29 DOF AtDof1,3 Dof-type zinc finger DNA-binding family protein (.1) AT1G07640 100 / 9e-26 DOF OBP2, AtDof1. 1 Dof-type zinc finger DNA-binding family protein (.1.2.3) AT1G51700 96 / 6e-25 DOF ADOF1, AtDof1. 7 DOF zinc finger protein 1 (.1) AT3G21270 96 / 8e-25 DOF ADOF2, AtDof3. 1 DOF zinc finger protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001896 [exp] 260 / 6e-90 AT2G34140 172 / 3e-55 Dof-type zinc finger DNA-binding family protein (.1) Lus10020314 [exp] 119 / 2e-32 AT5G62430 196 / 8e-59 cycling DOF factor 1 (.1) Lus10020315 [exp] 119 / 4e-32 AT5G62430 201 / 7e-60 cycling DOF factor 1 (.1) Lus10005677 [exp] 118 / 7e-32 AT5G62430 199 / 3e-59 cycling DOF factor 1 (.1) Lus10037167 [exp] 117 / 2e-31 AT5G39660 214 / 5e-65 cycling DOF factor 2 (.1.2) Lus10019093 [exp] 116 / 6e-31 AT3G47500 330 / 8e-109 cycling DOF factor 3 (.1) Lus10034461 [exp] 116 / 7e-31 AT3G47500 331 / 2e-109 cycling DOF factor 3 (.1) Lus10036760 [exp] 98 / 9e-25 AT5G39660 200 / 1e-60 cycling DOF factor 2 (.1.2) Lus10016566 [exp] 98 / 1e-24 AT3G55370 160 / 2e-46 OBF-binding protein 3 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G056900 [exp] 149 / 1e-46 AT1G29160 186 / 7e-61 Dof-type zinc finger DNA-binding family protein (.1) Potri.011G065900 [exp] 139 / 2e-42 AT1G29160 155 / 7e-49 Dof-type zinc finger DNA-binding family protein (.1) Potri.017G084600 [exp] 117 / 3e-31 AT5G39660 314 / 3e-102 cycling DOF factor 2 (.1.2) Potri.004G121800 [exp] 117 / 4e-31 AT3G47500 293 / 5e-94 cycling DOF factor 3 (.1) Potri.008G087800 [exp] 117 / 5e-31 AT3G47500 249 / 2e-77 cycling DOF factor 3 (.1) Potri.010G167600 [exp] 115 / 1e-30 AT3G47500 257 / 2e-80 cycling DOF factor 3 (.1) Potri.013G066700 [exp] 115 / 2e-30 AT3G47500 157 / 2e-42 cycling DOF factor 3 (.1) Potri.019G040700 [exp] 113 / 9e-30 AT5G39660 154 / 1e-41 cycling DOF factor 2 (.1.2) Potri.014G036600 [exp] 97 / 4e-25 AT1G47655 128 / 2e-36 Dof-type zinc finger DNA-binding family protein (.1) Potri.003G034200 [exp] 97 / 5e-25 AT1G51700 136 / 7e-40 DOF zinc finger protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02701 [flax] [poplar] zf-Dof Dof domain, zinc finger
Representative CDS sequence Show only first row Show all	>Lus10013905 pacid=23170100 polypeptide=Lus10013905 locus=Lus10013905.g ID=Lus10013905.BGIv1.0 annot-version=v1.0 ATGCCAAGTACCCAACCAGAGGCGGCCGGGATCAAGCTGTTCGGCAAAACCATCGCCATCATAAAGCCGCCGAAACAAGATCCAAAGCCGGAAGAAGACG ACGAGGAACCGAGCTTGGATAAGAAGCCGGAGAAGATAATTCCGTGCCCGAGGTGCAAAAGCATGGAGACCAAATTCTGTTACTTCAACAATTACAATGT CAATCAGCCTCGCCACTTCTGCAAAGGCTGCCAGCGATACTGGACGGCCGGCGGGGCCCTCCGCAACGTCCCCGTCGGGGCCGGAAGGAGGAAGAACAAG CCGCCCGGACGGGACAGCCCTCCGATCGGCGGCGGCGGAGGCGGCGGAGGAGGAGGTGGGTTTTTGGATCATGGGTTTGATGGTAGGAATCAGTTTCCGC TGGAGGATCCGGCGGTGGGCGAGTGGCACGTAGCGGCGGCGGGGATGCACGGTAGTGGATTGATGGATGTGTTTCCCATCAAGCGGCGGCGGTTGGACTC CGGCGGTCAACCTTGCTAG
AA sequence Show only first row Show all	>Lus10013905 pacid=23170100 polypeptide=Lus10013905 locus=Lus10013905.g ID=Lus10013905.BGIv1.0 annot-version=v1.0 MPSTQPEAAGIKLFGKTIAIIKPPKQDPKPEEDDEEPSLDKKPEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKNK PPGRDSPPIGGGGGGGGGGGFLDHGFDGRNQFPLEDPAVGEWHVAAAGMHGSGLMDVFPIKRRRLDSGGQPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34140	DOF	AtDof2. 3	Dof-type zinc finger DNA-bindi...		Lus10013905 [exp]	0	1
AT2G39940		COI1	CORONATINE INSENSITIVE 1, RNI-...		Lus10028265 [exp]	9.5	0.7976
AT5G05140			Transcription elongation facto...		Lus10039000 [exp]	10.7	0.8484
AT3G11890			Sterile alpha motif (SAM) doma...		Lus10021086 [exp]	12.1	0.8173
AT4G28240			Wound-responsive family protei...		Lus10033728 [exp]	18.8	0.7917
AT5G50530			CBS / octicosapeptide/Phox/Bem...		Lus10032625 [exp]	19.1	0.8231
AT2G28080			UDP-Glycosyltransferase superf...		Lus10021439 [exp]	21.1	0.8316
AT3G28410			F-box/RNI-like superfamily pro...		Lus10029357 [exp]	29.6	0.6995
AT3G15358			unknown protein		Lus10011176 [exp]	30.4	0.7997
AT1G77210		AtSTP14	sugar transport protein 14, su...		Lus10009714 [exp]	34.9	0.8071
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10002597 [exp]	42.0	0.7528

Compare expression of checked genes

Lus10013905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.