Lus10013906 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030215 58 / 2e-10 AT1G78880 195 / 3e-57 Ubiquitin-specific protease family C19-related protein (.1)
Lus10013986 58 / 2e-10 ND 55 / 7e-08
Lus10004993 56 / 6e-10 ND /
Lus10002600 51 / 6e-08 AT3G14770 62 / 1e-10 Nodulin MtN3 family protein (.1)
Lus10040838 50 / 2e-07 AT3G23950 57 / 2e-08 F-box family protein (.1)
Lus10011965 40 / 0.0001 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013906 pacid=23170077 polypeptide=Lus10013906 locus=Lus10013906.g ID=Lus10013906.BGIv1.0 annot-version=v1.0
ATGGATGTACTAGAAGCTGATTTGAAAGATGTTGAAGATGATATTGCTGCTATTGGCAAAAGGAAAGAAGAACCGAAGCAGAGACTTGCGTACGAGATGC
CGGCAAAGCTTCCTCCTTTATCTGGTAAAGCGATGTACAGCGTTTGGGAACAAGCGGGAACTAAGACGGACGATTTAACCTGTTCGGGGCGAAGATTTGC
TGAAGTTGAAGAGGAATACGACGTGTTCCTAAGGGACACGGTCGTGTCCTTTTTTCTGGAAAGTGACCCGAGACTTCCTGTTGGTAAGAACACGTACGTG
TTCCCTAAGGAACACGGCGTGTCCTATCTTCAGACGGGTTTTCAAGTTGTTTTCCTTCTTCGATTTGGAAGGGGCGATATAAATAGCCCGAGCAACCCTT
TTGACGGGACGGACATTATTCCAGATATATTTTCGAGTTCTTAG
AA sequence
>Lus10013906 pacid=23170077 polypeptide=Lus10013906 locus=Lus10013906.g ID=Lus10013906.BGIv1.0 annot-version=v1.0
MDVLEADLKDVEDDIAAIGKRKEEPKQRLAYEMPAKLPPLSGKAMYSVWEQAGTKTDDLTCSGRRFAEVEEEYDVFLRDTVVSFFLESDPRLPVGKNTYV
FPKEHGVSYLQTGFQVVFLLRFGRGDINSPSNPFDGTDIIPDIFSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013906 0 1
AT4G08180 ORP1C OSBP(oxysterol binding protein... Lus10035967 11.4 0.7904
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10031234 21.2 0.7834
Lus10004450 29.2 0.8273
AT5G46050 ATPTR3, PTR3 ARABIDOPSIS THALIANA PEPTIDE T... Lus10011786 33.3 0.8122
AT4G11170 Disease resistance protein (TI... Lus10009108 40.6 0.7434
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10005284 66.4 0.6885
AT5G41590 Protein of unknown function (D... Lus10028756 73.0 0.6895
AT2G41510 ATCKX1, CKX1 cytokinin oxidase/dehydrogenas... Lus10018039 111.7 0.7177
AT2G38920 SPX (SYG1/Pho81/XPR1) domain-c... Lus10015986 116.1 0.7020
Lus10019815 136.4 0.7010

Lus10013906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.