Lus10013911 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56891 89 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1)
AT1G06330 89 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1)
AT2G18196 80 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1)
AT4G10465 71 / 1e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT5G27690 72 / 4e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT1G71050 67 / 2e-14 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
AT4G08570 67 / 2e-14 Heavy metal transport/detoxification superfamily protein (.1)
AT1G22990 65 / 1e-13 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
AT3G56240 62 / 6e-13 ATX1, CCH copper chaperone (.1)
AT1G23000 64 / 3e-12 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001892 215 / 3e-72 AT1G06330 101 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1)
Lus10020704 86 / 2e-21 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1)
Lus10033250 84 / 3e-20 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1)
Lus10010147 84 / 3e-20 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1)
Lus10008284 83 / 4e-20 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1)
Lus10027470 76 / 1e-17 AT3G48970 167 / 2e-54 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016436 76 / 1e-17 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019676 76 / 1e-17 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 76 / 1e-17 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G065600 118 / 4e-34 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G107500 97 / 8e-26 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1)
Potri.004G056800 95 / 3e-25 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1)
Potri.006G024800 95 / 3e-25 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G106500 95 / 4e-25 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.001G452400 86 / 3e-21 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1)
Potri.011G149500 84 / 2e-20 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G079800 80 / 2e-19 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
Potri.007G087300 79 / 6e-19 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.018G150200 72 / 9e-17 AT1G06330 73 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10013911 pacid=23170054 polypeptide=Lus10013911 locus=Lus10013911.g ID=Lus10013911.BGIv1.0 annot-version=v1.0
ATGCCGATAACCGAGCTTAGCGTCCACATGTGTTGCCACGGCTGCGAGCTGAAGATCAAGAAGGCACTCCGAAGGCTAGACGGAGTTAACGAGATAGACA
TAGACATGTCAACGCAAAAGGTGACGGTGATGGGCTACGTTGACCAAGAAACCGTCCTCAAAGCCGTTAGGAAGACCGGCAGAAGAGCCGAGCTCTGGCC
GGACGGTTACAACCATTCAGAGTACGCGAGCTTCAACCAACAGAACTACAATTACCTACAGCAGCCGGCTTATCTCTTGCAAAACCAGCCGCCGCCTCAG
CAGCCAGCGCCGTCAGCGCCGCCATATGAGGATGTTGTAGATCATGATGAAGATCGGTACTACGTCGTTGACTCTGATCATCAACAAGGTCGTGTTGGGT
ATATGGCTTCTTATGATGATGAGGATAGCTACTATAGGGATTATCAACGACGGCCGGTGTTGTACTCGTTCGCCGACCAGCAGCCCGCGGCCGCCATGTT
TAGTGATGAGAATCCGCATGCTTGTTCCATGATGTGA
AA sequence
>Lus10013911 pacid=23170054 polypeptide=Lus10013911 locus=Lus10013911.g ID=Lus10013911.BGIv1.0 annot-version=v1.0
MPITELSVHMCCHGCELKIKKALRRLDGVNEIDIDMSTQKVTVMGYVDQETVLKAVRKTGRRAELWPDGYNHSEYASFNQQNYNYLQQPAYLLQNQPPPQ
QPAPSAPPYEDVVDHDEDRYYVVDSDHQQGRVGYMASYDDEDSYYRDYQRRPVLYSFADQQPAAAMFSDENPHACSMM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06330 Heavy metal transport/detoxifi... Lus10013911 0 1
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10005178 3.5 0.8419
AT1G13480 Protein of unknown function (D... Lus10031913 7.1 0.8816
AT5G61680 Pectin lyase-like superfamily ... Lus10034893 9.6 0.8496
Lus10022970 14.1 0.8126
AT1G51340 MATE efflux family protein (.1... Lus10042365 16.5 0.8548
AT2G42140 VQ motif-containing protein (.... Lus10004172 21.5 0.8375
AT4G12500 Bifunctional inhibitor/lipid-t... Lus10032258 22.6 0.7838
AT1G14190 Glucose-methanol-choline (GMC)... Lus10032346 29.7 0.8398
AT1G67030 C2H2ZnF ZFP6 zinc finger protein 6 (.1) Lus10017609 29.8 0.8393
AT4G10380 AtNIP5;1, NIP5;... NOD26-LIKE MIP 8, NOD26-LIKE M... Lus10033268 33.7 0.8257

Lus10013911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.