Lus10013928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29070 92 / 4e-24 Ribosomal protein L34 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000989 104 / 1e-26 AT2G34090 231 / 6e-71 maternal effect embryo arrest 18 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G064800 105 / 2e-29 AT1G29070 106 / 1e-29 Ribosomal protein L34 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00468 Ribosomal_L34 Ribosomal protein L34
Representative CDS sequence
>Lus10013928 pacid=23170076 polypeptide=Lus10013928 locus=Lus10013928.g ID=Lus10013928.BGIv1.0 annot-version=v1.0
ATGGCAGCTTCAGTGTCGATTATGTCCCCTTCCCCACCGTCGTTCAGAGCAGCTCAACCTCCTTCTCGCCTTGTCGCCACCGCTGCTCTCTCCCAAAACA
GAAATTTCTCCATCACCGCCGCCGCATCTCGCTCCGGCCTACTCCACTCTTCTTTCCTCTCTTCTCCCACTCCCGTTTCATCGTCTTTCTCGTCTTCCTT
CTCAGGTTTGTCACTCGGAATTGGGGATTTTAACTCCGGCAGCAATGGGATAAACCGCCGCGGCGGCGGGGGAAGGTTTGTGGTGAGAGCTGGGAAGGCG
GCGCTTTGCCTTACTAAAAGGAACAGGTCGTGCAAGTCTCTGGCGAGGACTCACGGATTCCGGCGACGGATGAAGACAACCGCCGGGAGGGCGATTTTGA
AGCGCCGACGTGCTAAAGGTCGTAAGGTTCTCTGCACCAAGACCAATTCAAACAGTGGCAAAAAGAGAAACAGAGCTTGA
AA sequence
>Lus10013928 pacid=23170076 polypeptide=Lus10013928 locus=Lus10013928.g ID=Lus10013928.BGIv1.0 annot-version=v1.0
MAASVSIMSPSPPSFRAAQPPSRLVATAALSQNRNFSITAAASRSGLLHSSFLSSPTPVSSSFSSSFSGLSLGIGDFNSGSNGINRRGGGGRFVVRAGKA
ALCLTKRNRSCKSLARTHGFRRRMKTTAGRAILKRRRAKGRKVLCTKTNSNSGKKRNRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 0 1
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10027894 1.7 0.9784
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 1.7 0.9814
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 2.0 0.9796
AT1G64510 Translation elongation factor... Lus10023054 2.0 0.9780
AT1G64510 Translation elongation factor... Lus10032419 2.2 0.9772
AT2G43030 Ribosomal protein L3 family pr... Lus10001337 4.2 0.9731
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Lus10037307 4.6 0.9678
AT2G43030 Ribosomal protein L3 family pr... Lus10013640 4.9 0.9674
AT3G15190 chloroplast 30S ribosomal prot... Lus10005538 5.2 0.9666
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Lus10025445 5.7 0.9608

Lus10013928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.