Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46090 104 / 1e-29 Protein of unknown function (DUF679) (.1) AT4G18425 103 / 3e-29 Protein of unknown function (DUF679) (.1) AT4G24310 100 / 7e-28 Protein of unknown function (DUF679) (.1) AT3G02430 91 / 4e-24 Protein of unknown function (DUF679) (.1) AT4G28485 88 / 8e-24 AtDMP7 Arabidopsis thaliana DUF679 domain membrane protein 7, DUF679 domain membrane protein 7 (.1) AT1G09157 71 / 1e-16 Protein of unknown function (DUF679) (.1) AT5G39650 69 / 1e-15 DAU2 DUO1-activated unknown 2, Protein of unknown function (DUF679) (.1) AT3G21550 64 / 3e-14 AtDMP2 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) AT3G21520 59 / 3e-12 AtDMP1 Arabidopsis thaliana DUF679 domain membrane protein 1, DUF679 domain membrane protein 1 (.1) AT5G27370 40 / 3e-05 Protein of unknown function (DUF679) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015394 [exp] 146 / 6e-46 AT4G18425 273 / 1e-93 Protein of unknown function (DUF679) (.1) Lus10013969 [exp] 146 / 7e-46 AT4G18425 274 / 5e-94 Protein of unknown function (DUF679) (.1) Lus10013975 [exp] 112 / 1e-32 AT4G18425 257 / 3e-87 Protein of unknown function (DUF679) (.1) Lus10036581 [exp] 106 / 3e-30 AT3G02430 255 / 1e-86 Protein of unknown function (DUF679) (.1) Lus10013974 [exp] 105 / 6e-30 AT4G18425 238 / 1e-79 Protein of unknown function (DUF679) (.1) Lus10015396 [exp] 104 / 2e-29 AT5G46090 239 / 3e-80 Protein of unknown function (DUF679) (.1) Lus10013971 [exp] 103 / 7e-29 AT5G46090 234 / 2e-78 Protein of unknown function (DUF679) (.1) Lus10039871 [exp] 94 / 8e-27 AT5G46090 122 / 3e-36 Protein of unknown function (DUF679) (.1) Lus10033645 [exp] 96 / 4e-26 AT5G46090 208 / 2e-68 Protein of unknown function (DUF679) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G058000 [exp] 124 / 2e-37 AT4G18425 247 / 8e-84 Protein of unknown function (DUF679) (.1) Potri.004G049000 [exp] 114 / 2e-33 AT4G18425 276 / 6e-95 Protein of unknown function (DUF679) (.1) Potri.017G016300 [exp] 101 / 1e-28 AT4G18425 203 / 2e-66 Protein of unknown function (DUF679) (.1) Potri.003G008600 [exp] 102 / 2e-28 AT3G02430 185 / 6e-59 Protein of unknown function (DUF679) (.1) Potri.004G223500 [exp] 97 / 2e-26 AT3G02430 195 / 1e-62 Protein of unknown function (DUF679) (.1) Potri.008G087000 [exp] 74 / 9e-18 AT1G09157 254 / 1e-85 Protein of unknown function (DUF679) (.1) Potri.010G168400 [exp] 71 / 1e-16 AT1G09157 223 / 2e-73 Protein of unknown function (DUF679) (.1) Potri.010G027600 [exp] 69 / 5e-16 AT3G21550 202 / 1e-66 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Potri.008G115100 [exp] 67 / 2e-15 AT3G21550 213 / 9e-71 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Potri.013G027200 [exp] 62 / 2e-13 AT5G27370 153 / 5e-47 Protein of unknown function (DUF679) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05078 [flax] [poplar] DUF679 Protein of unknown function (DUF679)
Representative CDS sequence Show only first row Show all	>Lus10013933 pacid=23170038 polypeptide=Lus10013933 locus=Lus10013933.g ID=Lus10013933.BGIv1.0 annot-version=v1.0 ATGTACAGCTTCAGGTTTATAGATTTTGTGCATGGGTTCATGTCAATGCTTGTGTTTGCAGCTGTTGCTCTGTTTGATCAGAATGTGGTTAGCTGCTTCT ACCCTGCGCCGCCAAATGAGTGTCAGGAGATACTCACTGCTATTCCGGTCGGTATCGGAGTTGTTTGTAGTATGTTGTTTGTTGTGTTCTCTACTAAGCG CCATGGAATTGAGTTTCCTCTCTCGACCAATAACTGA
AA sequence Show only first row Show all	>Lus10013933 pacid=23170038 polypeptide=Lus10013933 locus=Lus10013933.g ID=Lus10013933.BGIv1.0 annot-version=v1.0 MYSFRFIDFVHGFMSMLVFAAVALFDQNVVSCFYPAPPNECQEILTAIPVGIGVVCSMLFVVFSTKRHGIEFPLSTNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46090			Protein of unknown function (D...		Lus10013933 [exp]	0	1
					Lus10034979 [exp]	2.2	0.9430
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10023335 [exp]	3.2	0.9372
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10021233 [exp]	3.9	0.9313
					Lus10038613 [exp]	4.4	0.8995
AT1G77450	NAC	ANAC032	NAC domain containing protein ...		Lus10031937 [exp]	4.6	0.8968
AT2G41660		MIZ1	mizu-kussei 1, Protein of unkn...		Lus10018050 [exp]	4.9	0.9174
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10026625 [exp]	5.4	0.8824
AT3G11910		AtUBP13, UBP13	ubiquitin-specific protease 13...		Lus10013550 [exp]	5.5	0.9198
AT1G56140			Leucine-rich repeat transmembr...		Lus10031777 [exp]	5.9	0.9218
AT3G60160		ATMRP9, ABCC9	ATP-binding cassette C9, multi...		Lus10022808 [exp]	6.6	0.9126

Compare expression of checked genes

Lus10013933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.