Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45920 79 / 6e-20 SGNH hydrolase-type esterase superfamily protein (.1) AT5G62930 68 / 1e-15 SGNH hydrolase-type esterase superfamily protein (.1) AT2G38180 66 / 1e-14 SGNH hydrolase-type esterase superfamily protein (.1) AT3G11210 59 / 4e-12 SGNH hydrolase-type esterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000525 [exp] 110 / 4e-32 AT5G45920 337 / 4e-118 SGNH hydrolase-type esterase superfamily protein (.1) Lus10027675 [exp] 72 / 4e-17 AT5G62930 414 / 2e-148 SGNH hydrolase-type esterase superfamily protein (.1) Lus10004815 [exp] 64 / 6e-14 AT3G11210 323 / 3e-112 SGNH hydrolase-type esterase superfamily protein (.1) Lus10040197 [exp] 60 / 1e-12 AT3G11210 402 / 5e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10028290 [exp] 60 / 2e-12 AT3G11210 402 / 2e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10035506 [exp] 52 / 1e-09 AT3G11210 244 / 7e-79 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G063800 [exp] 97 / 7e-27 AT5G45920 357 / 6e-126 SGNH hydrolase-type esterase superfamily protein (.1) Potri.004G053800 [exp] 95 / 4e-26 AT5G45920 329 / 3e-115 SGNH hydrolase-type esterase superfamily protein (.1) Potri.012G081900 [exp] 75 / 2e-18 AT5G62930 403 / 3e-144 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116000 [exp] 61 / 8e-13 AT3G11210 306 / 1e-105 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G115800 [exp] 58 / 5e-12 AT3G11210 307 / 4e-106 SGNH hydrolase-type esterase superfamily protein (.1) Potri.006G100300 [exp] 57 / 2e-11 AT3G11210 327 / 8e-114 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116100 [exp] 56 / 3e-11 AT3G11210 337 / 9e-118 SGNH hydrolase-type esterase superfamily protein (.1) Potri.008G068000 [exp] 52 / 7e-10 AT3G11210 419 / 5e-150 SGNH hydrolase-type esterase superfamily protein (.1) Potri.010G189300 [exp] 51 / 2e-09 AT3G11210 414 / 4e-148 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0264 [flax] [poplar] SGNH_hydrolase PF00657 [flax] [poplar] Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Representative CDS sequence Show only first row Show all	>Lus10013940 pacid=23170127 polypeptide=Lus10013940 locus=Lus10013940.g ID=Lus10013940.BGIv1.0 annot-version=v1.0 ATGAGGCCAAAGATTTATCTGTTCGGCGACTCCATCACCGAGATGTCCTTCGCCGACGGCGGCGGCTGGGGCGCCTCCCTCACCAACCACTTCTGCCGCA CGGTGGATGTGGTGCTGAGAGGGTACAGCGGCTACAACTCGCGGTGGGGGCTGATGGGGGGCGAGAAGGTGGTCTCCGGCCCCACGTAG
AA sequence Show only first row Show all	>Lus10013940 pacid=23170127 polypeptide=Lus10013940 locus=Lus10013940.g ID=Lus10013940.BGIv1.0 annot-version=v1.0 MRPKIYLFGDSITEMSFADGGGWGASLTNHFCRTVDVVLRGYSGYNSRWGLMGGEKVVSGPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45920			SGNH hydrolase-type esterase s...		Lus10013940 [exp]	0	1
AT2G36970			UDP-Glycosyltransferase superf...		Lus10021437 [exp]	1.4	0.8783
AT5G45920			SGNH hydrolase-type esterase s...		Lus10013941 [exp]	2.6	0.9237
AT2G43120			RmlC-like cupins superfamily p...		Lus10001159 [exp]	4.9	0.8656
AT1G77220			Protein of unknown function (D...		Lus10028621 [exp]	5.2	0.8577
AT5G15080			Protein kinase superfamily pro...		Lus10030668 [exp]	7.1	0.8572
AT1G21390		EMB2170	embryo defective 2170 (.1)		Lus10000771 [exp]	9.4	0.7901
AT4G00750			S-adenosyl-L-methionine-depend...		Lus10041366 [exp]	13.2	0.8591
AT2G01275			RING/FYVE/PHD zinc finger supe...		Lus10034640 [exp]	14.5	0.8717
AT4G21865			unknown protein		Lus10023724 [exp]	16.5	0.8408
AT1G21780			BTB/POZ domain-containing prot...		Lus10029677 [exp]	16.6	0.8519

Compare expression of checked genes

Lus10013940 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.