Lus10013941 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45920 257 / 1e-87 SGNH hydrolase-type esterase superfamily protein (.1)
AT5G62930 169 / 4e-53 SGNH hydrolase-type esterase superfamily protein (.1)
AT3G11210 104 / 2e-27 SGNH hydrolase-type esterase superfamily protein (.1)
AT2G38180 89 / 3e-21 SGNH hydrolase-type esterase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000525 343 / 1e-121 AT5G45920 337 / 4e-118 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10027675 174 / 7e-55 AT5G62930 414 / 2e-148 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10039938 103 / 1e-28 AT5G62930 180 / 1e-58 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10028290 107 / 2e-28 AT3G11210 402 / 2e-143 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10004815 106 / 3e-28 AT3G11210 323 / 3e-112 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10040197 103 / 4e-27 AT3G11210 402 / 5e-143 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10027790 103 / 1e-26 AT2G38180 194 / 1e-59 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10035506 79 / 2e-17 AT3G11210 244 / 7e-79 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G053800 268 / 5e-92 AT5G45920 329 / 3e-115 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.011G063800 266 / 4e-91 AT5G45920 357 / 6e-126 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.012G081900 180 / 2e-57 AT5G62930 403 / 3e-144 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.008G068000 107 / 1e-28 AT3G11210 419 / 5e-150 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.006G100300 107 / 1e-28 AT3G11210 327 / 8e-114 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.016G116100 103 / 3e-27 AT3G11210 337 / 9e-118 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.010G189300 102 / 5e-27 AT3G11210 414 / 4e-148 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.016G115800 89 / 1e-21 AT3G11210 307 / 4e-106 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.016G116000 88 / 2e-21 AT3G11210 306 / 1e-105 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0264 SGNH_hydrolase PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Representative CDS sequence
>Lus10013941 pacid=23170040 polypeptide=Lus10013941 locus=Lus10013941.g ID=Lus10013941.BGIv1.0 annot-version=v1.0
ATGGCGGCGGAGAAGGTGTTTCCGGCACCGACGACGACGATGGCGACGTGGGCGGTGACGGTGTTCTTCGGGGCCAACGACGCTTGTCTTCCGGATAGGT
ACGGTGGGTTCCAGCACGTGCCTCTTGATGAGTACAAGCTCAACCTACGGTCCATTGTCTTCTTCATTAAGGACTGCTGGCCAAATACAGTGATTCTACT
CATAACTCCTCCTCCAATCGATGAAGAGGCTCGCCTCAAGAACCCGTACATGGATAACCCATCGGGTCTACCCGAGAGGACGAACCACGTGGCCGGCGAA
TACTCCAAGGGATGCATTGAGGTTGCTAAGGAATGTGGCTGCCCTGTGGTAGACCTATGGACCAAAATGCAACAGTTCCCAAATTGGCAAACTTCTTGCC
TCAGCGATGGATTGCACTTGACCCAGTTAGGGAACAAGATAGTGTTTGATGAAGTTGTGAAGAAGCTGGAGGAGCAAGGGCTGAGCGCTGAAACGATGCC
GTATGACTTGCCGGTTTTCTCGGACGTAGATTCCAAGGATCCATTGAAGAGCTTTCGAGATTAG
AA sequence
>Lus10013941 pacid=23170040 polypeptide=Lus10013941 locus=Lus10013941.g ID=Lus10013941.BGIv1.0 annot-version=v1.0
MAAEKVFPAPTTTMATWAVTVFFGANDACLPDRYGGFQHVPLDEYKLNLRSIVFFIKDCWPNTVILLITPPPIDEEARLKNPYMDNPSGLPERTNHVAGE
YSKGCIEVAKECGCPVVDLWTKMQQFPNWQTSCLSDGLHLTQLGNKIVFDEVVKKLEEQGLSAETMPYDLPVFSDVDSKDPLKSFRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45920 SGNH hydrolase-type esterase s... Lus10013941 0 1
AT5G45920 SGNH hydrolase-type esterase s... Lus10013940 2.6 0.9237
AT5G03380 Heavy metal transport/detoxifi... Lus10023924 4.0 0.9431
AT1G27980 DPL1, ATDPL1 dihydrosphingosine phosphate l... Lus10003129 4.5 0.9278
AT1G10650 SBP (S-ribonuclease binding pr... Lus10029136 4.5 0.9313
AT5G54840 ATSGP1 Ras-related small GTP-binding ... Lus10019615 6.9 0.9279
AT4G27290 S-locus lectin protein kinase ... Lus10014810 7.1 0.9280
AT5G50760 SAUR-like auxin-responsive pro... Lus10011332 7.5 0.9206
AT4G21450 PapD-like superfamily protein ... Lus10002595 8.3 0.9002
AT2G20900 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.... Lus10033732 9.2 0.8962
AT3G52850 VSR1;1, GFS1, B... VACUOLAR SORTING RECEPTOR 1;1,... Lus10025220 9.4 0.9140

Lus10013941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.