Lus10013946 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 206 / 5e-69 Histone superfamily protein (.1)
AT5G10400 206 / 5e-69 Histone superfamily protein (.1)
AT5G10390 206 / 5e-69 Histone superfamily protein (.1)
AT3G27360 206 / 5e-69 Histone superfamily protein (.1)
AT1G09200 206 / 5e-69 Histone superfamily protein (.1)
AT4G40040 206 / 7e-69 Histone superfamily protein (.1.2)
AT4G40030 206 / 7e-69 Histone superfamily protein (.1.2.3)
AT5G10980 206 / 7e-69 Histone superfamily protein (.1)
AT1G75600 197 / 2e-65 Histone superfamily protein (.1)
AT5G65350 194 / 5e-64 HTR11 histone 3 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 207 / 2e-69 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 207 / 2e-69 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 207 / 2e-69 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 207 / 2e-69 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 207 / 2e-69 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10012744 207 / 4e-69 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10031252 206 / 9e-69 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10031821 208 / 1e-68 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 205 / 2e-67 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 207 / 2e-69 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016900 206 / 5e-69 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 206 / 7e-69 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 206 / 7e-69 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10013946 pacid=23170091 polypeptide=Lus10013946 locus=Lus10013946.g ID=Lus10013946.BGIv1.0 annot-version=v1.0
ATGGCTCGCACCAAGCAAACAGCTCGCAAGTCCACCGGAGGCAAGGCGCCAAGGAAGCAGCTGGCCACCAAGGCAGCAAGGAAGTCAGCTCCGGCTACCG
GAGGAGTGAAGAAGCCCCACAGATTCAGACCAGGAACCGTTGCCCTCCGTGAGATCCGCAAGTACCAGAAGAGCACCGAGCTTCTGATCCGTATCTTCCC
TTCCAGCGCCTTGTCCGTGAGATCGCCCAGGATTTCAAGACAGATCTCAGGTTCCAGAGCTCCGCCGTTTCTGCTCTCCAGGAAGCCGCCGAGGCTTACC
TCGTCGGACTGTTCGAGGATACCAACCTCTGCGCCATTCACGCCAAGAGGGTTACTATCATGCCCAAGGATATCCAGCTCGCCAGGAGAATCAGAGGCGA
GCGTGCTTAGATTTGACCCAGGGTTCCAAACCCACGCCGTCTCTGCTCTCCAGGAAGCCGCCGAGGCTTACCTCGTCGGACTGTTCGAGGATACCAACCT
CTGCGCCATTCACGCCAAGAGGGTTACTATCATGCCCAAGGATATCCAGCTCGCCAGGAGAATCAGAGGCGAGCGTGCTTAG
AA sequence
>Lus10013946 pacid=23170091 polypeptide=Lus10013946 locus=Lus10013946.g ID=Lus10013946.BGIv1.0 annot-version=v1.0
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRIFPSSALSVRSPRISRQISGSRAPPFLLSRKPPRLT
SSDCSRIPTSAPFTPRGLLSCPRISSSPGESEASVLRFDPGFQTHAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G40030 Histone superfamily protein (.... Lus10013946 0 1
AT3G53730 Histone superfamily protein (.... Lus10023331 1.4 0.9701
AT5G10400 Histone superfamily protein (.... Lus10031822 3.7 0.9585
AT5G59970 Histone superfamily protein (.... Lus10028464 4.0 0.9524
AT3G27360 Histone superfamily protein (.... Lus10031252 5.0 0.9470
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853 6.7 0.9526
AT3G54560 HTA11 histone H2A 11 (.1) Lus10018753 6.9 0.9458
AT3G16080 Zinc-binding ribosomal protein... Lus10011446 7.9 0.9161
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10013544 7.9 0.9413
AT3G46940 DUT1 DUTP-PYROPHOSPHATASE-LIKE 1 (.... Lus10010809 10.5 0.9357
AT1G78650 POLD3 DNA-directed DNA polymerases (... Lus10039192 10.7 0.9135

Lus10013946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.