Lus10013951 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013977 228 / 2e-75 AT1G29010 52 / 1e-07 unknown protein
Lus10015398 136 / 6e-40 AT1G29010 46 / 1e-05 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013951 pacid=23170031 polypeptide=Lus10013951 locus=Lus10013951.g ID=Lus10013951.BGIv1.0 annot-version=v1.0
ATGGGTTCTTCCAACAATGGAGCTTCTTCTTTGGATCATCAAATGCAGAGGAACCAACAACCTTCTTACCCCACTATGATGAATTTCTTCCCAAGTTCTT
CATCATCTGGAGTAGAGCCCCCTTCAAACCAAAGCCGCCATTTTCCAGACAAACCAAGCGTTATGATCGGAGGAAAAAGACAGTGTCCATTCTACATTGG
TGATAATACAGTAGCAGCTGAAACTCCATCATCATTCCGATTCCAATCTCCTTCCTATCTACCTTATTTCTCACCCAGAACGAATCACGACACAGATTCA
AGAGGGAATTTGGTGCTGTTGGGTTGTCCTACAACAACCAGAGAAAGGCATTCAATGTTATACAATCATCCTCCTCAAATGCAGCAAAGATCAGTAGAGG
CTTATGCTTCTTATGAAGGGTCGATGATGAACAAGGCGCCGCCTTTATTCTACAGCTTCTTGGAAGAGCCGGCTGGAATTGTGCGCAAGGGCGAGACAGA
GTTGATTAGTGAAGAAGAAGGAGATGGGATTGATCTGAGATTGAAGCTGTGA
AA sequence
>Lus10013951 pacid=23170031 polypeptide=Lus10013951 locus=Lus10013951.g ID=Lus10013951.BGIv1.0 annot-version=v1.0
MGSSNNGASSLDHQMQRNQQPSYPTMMNFFPSSSSSGVEPPSNQSRHFPDKPSVMIGGKRQCPFYIGDNTVAAETPSSFRFQSPSYLPYFSPRTNHDTDS
RGNLVLLGCPTTTRERHSMLYNHPPQMQQRSVEAYASYEGSMMNKAPPLFYSFLEEPAGIVRKGETELISEEEGDGIDLRLKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013951 0 1
AT1G48930 ATGH9C1 glycosyl hydrolase 9C1 (.1) Lus10017402 4.8 0.7550
AT1G12560 ATHEXPALPHA1.26... expansin A7 (.1) Lus10006711 6.9 0.7537
AT4G30320 CAP (Cysteine-rich secretory p... Lus10019993 9.4 0.7343
AT5G20260 Exostosin family protein (.1) Lus10027707 9.9 0.6543
AT4G02270 RHS13 root hair specific 13 (.1) Lus10013419 11.1 0.7525
AT1G63450 RHS8 root hair specific 8 (.1) Lus10000604 11.2 0.7335
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10009837 14.1 0.7216
AT5G05500 MOP10 Pollen Ole e 1 allergen and ex... Lus10040948 16.2 0.6977
Lus10040759 16.3 0.7177
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028896 18.8 0.6990

Lus10013951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.