Lus10013961 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60860 413 / 5e-149 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 400 / 9e-144 AtRABA1g RAB GTPase homolog A1G (.1)
AT1G28550 391 / 3e-140 AtRABA1i RAB GTPase homolog A1I (.1)
AT2G33870 386 / 2e-138 ArRABA1h RAB GTPase homolog A1H (.1)
AT4G18430 380 / 3e-136 AtRABA1e RAB GTPase homolog A1E (.1)
AT4G18800 357 / 4e-127 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G45750 351 / 2e-124 AtRABA1c RAB GTPase homolog A1C (.1)
AT1G16920 335 / 2e-118 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G06400 326 / 1e-114 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G09630 309 / 7e-108 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015297 422 / 1e-152 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10025432 419 / 1e-151 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10002178 408 / 5e-147 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10017679 407 / 7e-147 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
Lus10039895 381 / 1e-136 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Lus10029253 352 / 9e-125 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 349 / 1e-123 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10020746 321 / 1e-112 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029789 320 / 2e-112 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G061300 406 / 3e-146 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.013G123600 405 / 8e-146 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 404 / 2e-145 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.001G374000 396 / 2e-142 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.011G070300 352 / 1e-124 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 347 / 8e-123 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.003G004100 310 / 2e-108 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.008G061300 301 / 4e-105 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 299 / 5e-104 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.006G000300 298 / 2e-103 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10013961 pacid=23170117 polypeptide=Lus10013961 locus=Lus10013961.g ID=Lus10013961.BGIv1.0 annot-version=v1.0
ATGGCATACAGAGCCGACGACGATTACGATTACTTGTTCAAGGTGGTCTTGATTGGCGACTCAGGTGTCGGGAAATCCAACCTTCTGTCCCGTTTCACGA
GGAACGAGTTCAGCCTCGAATCGAAATCGACCATCGGGGTTGAGTTCGCAACTCGTAGCATCCATGTTGATGACAAGGTCGTCAAGGCTCAGATTTGGGA
CACCGCCGGCCAAGAAAGGTACCGAGCCATAACGAGCGCATACTACAGAGGAGCAGTGGGAGCGTTACTAGTCTACGATGCAACCCGCCACGTGACTTTC
GAGAACGTCGAGAGGTGGCTAAAGGAGCTTCGAGACCACACGGATGCGAACATCGTGATCATGCTAGTGGGCAACAAGGCCGATCTCCGCCACTTGAGGG
CGGTCTCCATGGAGGATGCAAGGTCATTTGCAGAGCGGGAGAGCACATTCTTTATGGAGACATCGGCTCTCGAGTCGTTGAACGTGGAGAGCGCCTTCAC
GGAGGTGCTCACACAAATTTATCGAGTCGTCAGCAGGAAGGCGCTCGATATTGGTGATGATCCCGGTGCGTTGCCTCGAGGGCAGATGATCAATGTGGGT
GGCAGAGATGATGTATCGGCTGTGAAGAAGGGTGGTTGTTGCTCTTCTTGA
AA sequence
>Lus10013961 pacid=23170117 polypeptide=Lus10013961 locus=Lus10013961.g ID=Lus10013961.BGIv1.0 annot-version=v1.0
MAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDATRHVTF
ENVERWLKELRDHTDANIVIMLVGNKADLRHLRAVSMEDARSFAERESTFFMETSALESLNVESAFTEVLTQIYRVVSRKALDIGDDPGALPRGQMINVG
GRDDVSAVKKGGCCSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10013961 0 1
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10004042 5.3 0.9185
Lus10022805 7.5 0.9185
AT5G05530 RING/U-box superfamily protein... Lus10024629 9.2 0.9185
AT2G15220 Plant basic secretory protein ... Lus10026579 10.6 0.9185
Lus10011962 11.8 0.9185
AT2G20340 Pyridoxal phosphate (PLP)-depe... Lus10012601 13.0 0.9185
AT5G49180 Plant invertase/pectin methyle... Lus10023775 13.9 0.7142
AT5G04350 Plant self-incompatibility pro... Lus10029388 14.0 0.9185
Lus10030558 15.0 0.9185
AT1G27880 DEAD/DEAH box RNA helicase fam... Lus10015818 15.4 0.5766

Lus10013961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.