Lus10013963 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013963 pacid=23170082 polypeptide=Lus10013963 locus=Lus10013963.g ID=Lus10013963.BGIv1.0 annot-version=v1.0
ATGGATAAGATCAAGCGTGAGTTTAAAGAAGCTTCCCTTCAAATATCCGGTAAAGGGCATTTTGGAATCTATCTCCTCCAGGTTGTCACTGTGATTCCAT
CTCTTCTGTATAGTTGCAGCTTTGGTGGTTTCCAGCACTTTACCTTAGTTAGGAATATACAGCAGCAAGCAGCTTTGGTGTTCAACTGTAGGATTAATAA
TGCCTGCTGCTGCAAGTGA
AA sequence
>Lus10013963 pacid=23170082 polypeptide=Lus10013963 locus=Lus10013963.g ID=Lus10013963.BGIv1.0 annot-version=v1.0
MDKIKREFKEASLQISGKGHFGIYLLQVVTVIPSLLYSCSFGGFQHFTLVRNIQQQAALVFNCRINNACCCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013963 0 1
AT5G60010 ferric reductase-like transmem... Lus10019390 5.1 0.9587
Lus10025503 5.5 0.9043
AT2G15220 Plant basic secretory protein ... Lus10026584 7.0 0.8612
Lus10040397 7.2 0.9587
AT1G04670 unknown protein Lus10004041 8.8 0.9587
Lus10027066 10.2 0.9587
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 11.4 0.9587
AT5G17680 disease resistance protein (TI... Lus10028043 11.7 0.8657
Lus10006918 12.5 0.9587
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10009924 13.0 0.8464

Lus10013963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.