Lus10013966 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14650 518 / 5e-175 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
AT1G14640 443 / 2e-146 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G06520 118 / 2e-27 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G12280 102 / 7e-23 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.2)
AT4G16200 99 / 1e-22 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G06890 58 / 9e-11 Ubiquitin-like superfamily protein (.1)
AT3G49130 59 / 3e-09 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
AT2G43960 53 / 3e-07 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1)
AT5G55100 51 / 2e-06 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
AT1G18050 49 / 4e-06 SWAP (Suppressor-of-White-APricot)/surp RNA-binding domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007278 518 / 3e-178 AT1G14650 512 / 3e-174 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10035958 514 / 2e-173 AT1G14650 886 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10025704 401 / 2e-136 AT1G14650 346 / 4e-114 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10025705 395 / 1e-132 AT1G14650 365 / 5e-120 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10015391 177 / 8e-53 AT1G14650 119 / 4e-32 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Lus10043105 50 / 4e-06 AT5G55100 504 / 1e-165 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Lus10032646 49 / 1e-05 AT5G55100 499 / 3e-164 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G070700 590 / 0 AT1G14650 810 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.005G094600 577 / 0 AT1G14650 814 / 0.0 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein (.2)
Potri.001G356800 51 / 3e-06 AT5G55100 420 / 6e-133 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein (.2)
Potri.001G269900 43 / 0.0006 AT3G52120 500 / 3e-176 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
Potri.009G064600 43 / 0.0008 AT3G52120 509 / 1e-179 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.1), SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
CL0072 PF12230 PRP21_like_P Pre-mRNA splicing factor PRP21 like protein
CL0072 PF01805 Surp Surp module
Representative CDS sequence
>Lus10013966 pacid=23170112 polypeptide=Lus10013966 locus=Lus10013966.g ID=Lus10013966.BGIv1.0 annot-version=v1.0
ATGCCAGGCACAGCAATTTTGTCTCTGCAAGCACCTCCTCCTCACTCAGAAGGAGCTCCGGTTGCTACCCACACCAGAACCATTGGAATTATACATCCTC
CTCCAGGTATCCGGAATATTGTTGACAAAACCGCACAGTTTGTTGCCGAAAAGGGACCCGAGTTTGAGAAAACGATTATGGATCGTACTGCCAAAAATGA
TAACTTCAAGTTTTTGAATCCCAACGATCCGTATCATGCGTATTATCAACATCTTTTGTCCGAGTCTCGCACCCAGAATCTGTCTTCTATGCAACAGCCT
GCTGATGATGATGGAAGCGAAGCAGCTCCAAAGCCTGACCCTGCTGCCCAATTTAGACTACCAACTCGAAAGGTTTTTGAACCACCTGAATCAGAGCAGT
ATACAGTTCGGATTCCTGAAGGGATTACTGGAGAAGAACGTGATATTATTAAGGTGACTGCACAGTTTGTAGCGCGAAATGGGAAAACATTCCTTACTGG
GCTCACTAATAGGGAGATGAACAACCCCCAGTTCCACTTTATGATGCCAACCCACAGCATGTTTACTTTCTTCACAGGGCTTGCAGATGCCTATTCAAAA
GTCCTGATGCCTCCAAAAGGTTTAACAGAGAAGTTGACGAACAGTGTTGCTGACATGACCGCTGTGCTTGAGAGATGCGTGACTCTTGAGGAGGTCACAA
GGAGAAGCAAGGTAATGGCTATGGAGGAAGACGAAATTGTTGAACCGGGGAAGGAGGTTGAAATGGAAATGGATGAAGAGGAGGTGAAGCTTGTTGAAGA
AGGCATGAGAGCATCGAACATTGATGAGAAGAATGCTTTGAACGCTAATGAGGAACCTGAACAACCAATTAGAATTGTGAAGAACTGGAAGAGACCTGAG
GAGAGGCTGCCAGCTGAAAGAGATCCTGCAAAGTTTGTTGTTTCCCCAATTACTAGAGAGCTGATTCCTATTCATGAAATGTCAGAACACATGAGGATTT
CCCTAATTGATCCCAAGTACAAGGAGCAAAAGGAGAGGATGTTTGCCAAGATTCGGGAGACCATTCTTGCTGGCGATGATGAAATTTCGAAAAATATTGT
GGGCCTTGCACGAACCCGTCCTGATATCTTTGGCACAACAGAGGAGGAGGTGTCTAATGCCGTTCAAGCTGAAATTGTGAAAAAGAAAGATGAGCAACCA
AAGCAGGTCATATGGGATGGCCACACTGGAAGCATTGGGCGGAATTCTAACCAGGCAATGTCCCAAAGTCTTGGTGACGACGATCAAAATAAGGCTACGA
ACAGTGACCGACAAAACTTACTTCGACCAGCTGCTCCTCCTCACTGTCCTGGTGTACCATCACTTCTACCGCTGGCTCCGAATGCAGTCTCATATTCAAC
TTCTATGGGTGGTGGATATCCTGTCCCTCTGCCAACGCCACCGGGTATGCCATTGATGCCATCAATTCGTCCACCACCGATGATGATGATGAATCAACTT
TCGTCTACGAATCCACCAAACATGCCAGTACCACCTCCATCAGGGTCTCAGTTTTCTCTCATGCCAATGCACCGTCCTTTCGCCCCTGTGCCTATGTCTA
TGCCTCCACCACACATGCACGCTATGGCCCCTCCTCCACTTCCAGAAGAACCTGAGCCAAAGAGGCAGAAGCTAGATGATTCAATGCTCATTCCAGAAGA
GCAGTTTTTGGCCCAGCATCATGGACCTGCAAGCATCAATGTTACTGTTCCAAGTGTCGATGAAGGAAATCTAAGAGGTCAAGTGCTGGAGATTAGAGTA
GAATCCTTGTCAGAAACAATTCTCAGTGTGAAGGAGAAGATTGCTGGAGAGATTCAACTTGCTTCCAATAAGCAGAAATTGATGAGTCAAAAGGCTCGTT
TTCTCAAGGATAATATGAGCCTTGCTTACTACAATCTCCGCGGTGGAGATTCACTTACTTTGACGTTGAGAGAGCGTGGTGGGAGAAAGAAATAA
AA sequence
>Lus10013966 pacid=23170112 polypeptide=Lus10013966 locus=Lus10013966.g ID=Lus10013966.BGIv1.0 annot-version=v1.0
MPGTAILSLQAPPPHSEGAPVATHTRTIGIIHPPPGIRNIVDKTAQFVAEKGPEFEKTIMDRTAKNDNFKFLNPNDPYHAYYQHLLSESRTQNLSSMQQP
ADDDGSEAAPKPDPAAQFRLPTRKVFEPPESEQYTVRIPEGITGEERDIIKVTAQFVARNGKTFLTGLTNREMNNPQFHFMMPTHSMFTFFTGLADAYSK
VLMPPKGLTEKLTNSVADMTAVLERCVTLEEVTRRSKVMAMEEDEIVEPGKEVEMEMDEEEVKLVEEGMRASNIDEKNALNANEEPEQPIRIVKNWKRPE
ERLPAERDPAKFVVSPITRELIPIHEMSEHMRISLIDPKYKEQKERMFAKIRETILAGDDEISKNIVGLARTRPDIFGTTEEEVSNAVQAEIVKKKDEQP
KQVIWDGHTGSIGRNSNQAMSQSLGDDDQNKATNSDRQNLLRPAAPPHCPGVPSLLPLAPNAVSYSTSMGGGYPVPLPTPPGMPLMPSIRPPPMMMMNQL
SSTNPPNMPVPPPSGSQFSLMPMHRPFAPVPMSMPPPHMHAMAPPPLPEEPEPKRQKLDDSMLIPEEQFLAQHHGPASINVTVPSVDEGNLRGQVLEIRV
ESLSETILSVKEKIAGEIQLASNKQKLMSQKARFLKDNMSLAYYNLRGGDSLTLTLRERGGRKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14650 SWAP (Suppressor-of-White-APri... Lus10013966 0 1
AT4G28610 GARP ATPHR1, PHR1 phosphate starvation response ... Lus10022886 4.9 0.8027
AT2G01190 PDE331 PIGMENT DEFECTIVE 331, Octicos... Lus10007952 9.7 0.7998
AT1G72740 MYB Homeodomain-like/winged-helix ... Lus10040111 10.2 0.7237
AT1G48420 DCD, ATACD1, AC... A. THALIANA 1-AMINOCYCLOPROPAN... Lus10031325 10.4 0.7782
AT3G21610 Acid phosphatase/vanadium-depe... Lus10000883 12.2 0.8057
AT4G26100 CKL1, CK1 casein kinase 1 (.1) Lus10027628 16.6 0.7868
AT3G15000 cobalt ion binding (.1) Lus10014696 19.5 0.7750
AT5G05660 EBI, ATNFXL2 NFX1-like 2, EARLY BIRD, Arabi... Lus10040200 24.9 0.7923
AT2G01190 PDE331 PIGMENT DEFECTIVE 331, Octicos... Lus10013486 34.0 0.7824
AT1G48420 DCD, ATACD1, AC... A. THALIANA 1-AMINOCYCLOPROPAN... Lus10031898 34.9 0.7648

Lus10013966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.