Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015401 [exp] 135 / 3e-43 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013980 pacid=23170036 polypeptide=Lus10013980 locus=Lus10013980.g ID=Lus10013980.BGIv1.0 annot-version=v1.0 ATGTTTCGTGATAGCAAAGTGTTCCATGATGGTCATGATCCTGATATCCGGCCAGCGAAGAAGCGCAAAAACGATGAACCGAGACTTCTCAGGAACGACG AGAACCAAGTTCCGAGACGCAAGAACGAGGAACATAAGAGGAAGAAAGAGGCACTACAGAGACGAGACCAAGATCGCGAATCGAGAAAGGAGAACGATAG ATATGTGCATGAAAGGAGGCAGCTTGATGAGGAAAGAACGTTTCAGAAAGAGTATCTAATGGCATGA
AA sequence Show only first row Show all	>Lus10013980 pacid=23170036 polypeptide=Lus10013980 locus=Lus10013980.g ID=Lus10013980.BGIv1.0 annot-version=v1.0 MFRDSKVFHDGHDPDIRPAKKRKNDEPRLLRNDENQVPRRKNEEHKRKKEALQRRDQDRESRKENDRYVHERRQLDEERTFQKEYLMA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013980 [exp]	0	1
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10040112 [exp]	4.6	0.7074
AT1G65440		GTB1	global transcription factor gr...		Lus10029085 [exp]	22.6	0.7521
AT1G48590			Calcium-dependent lipid-bindin...		Lus10042002 [exp]	31.9	0.7428
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10028361 [exp]	39.9	0.7394
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Lus10036571 [exp]	41.0	0.7164
AT3G22060			Receptor-like protein kinase-r...		Lus10039698 [exp]	44.5	0.7149
AT4G04960			Concanavalin A-like lectin pro...		Lus10025441 [exp]	50.3	0.7331
AT5G48790			Domain of unknown function (DU...		Lus10007599 [exp]	67.7	0.7124
AT1G13360			unknown protein		Lus10034310 [exp]	128.5	0.6791
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10004984 [exp]	174.3	0.6644

Compare expression of checked genes

Lus10013980 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.