Lus10013990 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26990 63 / 4e-12 Drought-responsive family protein (.1)
AT3G05700 61 / 4e-11 Drought-responsive family protein (.1)
AT1G56280 46 / 4e-06 ATDI19 drought-induced 19 (.1.2)
AT3G06760 44 / 2e-05 Drought-responsive family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015412 274 / 1e-93 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Lus10015214 74 / 2e-16 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
Lus10031467 62 / 1e-11 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10037717 59 / 6e-10 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1)
Lus10017097 54 / 5e-09 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10037819 47 / 4e-06 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10010305 40 / 0.0005 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10013420 40 / 0.0008 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G057200 182 / 8e-58 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2)
Potri.013G011200 71 / 5e-15 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.005G020900 67 / 2e-13 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1)
Potri.010G000800 58 / 4e-10 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.008G213400 56 / 2e-09 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.012G086500 46 / 3e-06 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Potri.019G027300 39 / 0.0003 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence
>Lus10013990 pacid=23170084 polypeptide=Lus10013990 locus=Lus10013990.g ID=Lus10013990.BGIv1.0 annot-version=v1.0
ATGGATTCGAATTTCTGGACGTCGAGGATCGCCGCCGCGAAGCGGCAGTACACTTTGAACCACCATAACCAGACCTCCCACCTGGATCGGTTGAGCGTTG
AGGAGTTCGAGGTGGAGGAGGATGTCCGGCCGGACATCCCTTGCCCTTACTGTTACGAGGCGTTCGTCGTCTTGTCTCTCAGTTCGCATCTGGAGGAGGA
GCATCCTTGCGAGTCCAGAGTCACCAGACGTCGCAGGCTACGCAGAGTTGCAATCCCCAACAGTCAAACACTGTCCCTTCTTGGCCGGGATCTACGCGAG
GCACATCTGCAAATTCTGCTAGGTGGTGGTGATGTTGGAAGTGGATATAGATTATCATCAGCATCGAGCAATGCTAATGTCTCGACGACTTCTGAAGCAG
CTACTGATCCTTTCCTTTCGTCGCTCATCTTGAATTTCCCATCCTCCGAAGTAGAAGAGATTTCGAAATCTGTCGTGACAGGTTCAGATGACTCCTTTGT
AAAGAGCAGCAGTGCTTCTCCCTACGTATGGAGGTCAAGCTTTGATCCGTCGCTGAGCCCCGAAGAACGGGAGAAGAAGATGAAGCAAGCTGCTGGGAGA
GCTGGTTTTGTGCAGAATCTAGTTCTGTCAACTTTGTCACTAGACTGA
AA sequence
>Lus10013990 pacid=23170084 polypeptide=Lus10013990 locus=Lus10013990.g ID=Lus10013990.BGIv1.0 annot-version=v1.0
MDSNFWTSRIAAAKRQYTLNHHNQTSHLDRLSVEEFEVEEDVRPDIPCPYCYEAFVVLSLSSHLEEEHPCESRVTRRRRLRRVAIPNSQTLSLLGRDLRE
AHLQILLGGGDVGSGYRLSSASSNANVSTTSEAATDPFLSSLILNFPSSEVEEISKSVVTGSDDSFVKSSSASPYVWRSSFDPSLSPEEREKKMKQAAGR
AGFVQNLVLSTLSLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26990 Drought-responsive family prot... Lus10013990 0 1
AT3G27530 MAG4, GC6 MAIGO 4, golgin candidate 6 (.... Lus10032089 4.1 0.9078
AT4G28390 ATAAC3, AAC3 ADP/ATP carrier 3 (.1) Lus10018611 8.9 0.8829
AT5G49510 PFD3, PDF3 prefoldin 3 (.1.2) Lus10043046 15.6 0.8918
AT5G61240 Leucine-rich repeat (LRR) fami... Lus10037108 18.9 0.8738
AT2G44420 protein N-terminal asparagine ... Lus10033495 20.6 0.9023
AT3G11040 AtENGase85B Endo-beta-N-acetyglucosaminida... Lus10007526 20.7 0.8798
AT2G45320 unknown protein Lus10000786 21.4 0.8814
AT4G09900 ATMES12 ARABIDOPSIS THALIANA METHYL ES... Lus10005298 22.0 0.8887
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10019983 24.7 0.8825
AT2G20780 AtPLT4 Major facilitator superfamily ... Lus10039812 25.3 0.8757

Lus10013990 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.