Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53940 155 / 4e-50 Yippee family putative zinc-binding protein (.1) AT2G40110 144 / 9e-46 Yippee family putative zinc-binding protein (.1.2) AT3G08990 143 / 2e-45 Yippee family putative zinc-binding protein (.1.2) AT3G11230 133 / 2e-41 Yippee family putative zinc-binding protein (.1.2) AT3G55890 132 / 4e-41 Yippee family putative zinc-binding protein (.1) AT4G27745 100 / 1e-28 Yippee family putative zinc-binding protein (.1) AT4G27740 96 / 5e-27 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015416 [exp] 209 / 2e-71 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1) Lus10028300 [exp] 145 / 4e-46 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 144 / 1e-45 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10035531 [exp] 135 / 4e-42 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) Lus10027762 [exp] 135 / 4e-42 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10007773 [exp] 108 / 1e-31 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 107 / 4e-31 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 106 / 5e-31 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10023244 [exp] 100 / 2e-28 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G115700 [exp] 160 / 3e-52 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 142 / 8e-45 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.008G067100 [exp] 141 / 4e-44 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.016G115000 [exp] 136 / 2e-42 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.006G015500 [exp] 107 / 2e-31 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.001G085400 [exp] 107 / 2e-31 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 101 / 3e-29 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019200 [exp] 101 / 4e-29 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.015G009100 [exp] 101 / 4e-29 AT4G27740 131 / 4e-41 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 101 / 4e-29 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10013992 pacid=23170093 polypeptide=Lus10013992 locus=Lus10013992.g ID=Lus10013992.BGIv1.0 annot-version=v1.0 ATGGGAAGAGTGTTTGTGGTGGAATTGGACGGCAGGTGTTACCGGTGCAGGTTCTGCAACACGCCTCTCGCCCTCGCCGATGATGTAATCTCCCGGACTT TCAATTGTCGGCAAGGGAGGGCTTACTTGTTCAGCAATGTAGTGAATGTAACAGTTGGAATGACAGAGGAAAGGATGATGCTTTCTGGTACTCATACCGT TGAAGACGTGTTCTGCTGCCGATGTGGACAAATTCTCGGCTGGACATATGTAGCTGCGCATGACAAAACCCAGAAATACAAGGAAGGGAAGTTTGTTCTT GAGAGGCAAGTACTCTGCTTTTTCTTCAATCCCAGTCTTCATGGTTTTTGTTAG
AA sequence Show only first row Show all	>Lus10013992 pacid=23170093 polypeptide=Lus10013992 locus=Lus10013992.g ID=Lus10013992.BGIv1.0 annot-version=v1.0 MGRVFVVELDGRCYRCRFCNTPLALADDVISRTFNCRQGRAYLFSNVVNVTVGMTEERMMLSGTHTVEDVFCCRCGQILGWTYVAAHDKTQKYKEGKFVL ERQVLCFFFNPSLHGFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53940			Yippee family putative zinc-bi...		Lus10013992 [exp]	0	1
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042470 [exp]	5.5	0.8152
AT2G22420			Peroxidase superfamily protein...		Lus10035925 [exp]	5.7	0.7867
AT5G58070		ATTIL	temperature-induced lipocalin ...		Lus10036298 [exp]	11.0	0.7962
AT2G46220			Uncharacterized conserved prot...		Lus10010135 [exp]	17.8	0.7723
AT2G46220			Uncharacterized conserved prot...		Lus10012651 [exp]	20.6	0.7677
AT4G22950	MADS	AGL19	AGAMOUS-like 19 (.1)		Lus10006715 [exp]	28.7	0.7673
AT4G14600			Target SNARE coiled-coil domai...		Lus10041130 [exp]	31.4	0.7021
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10020873 [exp]	33.6	0.7378
AT1G18060			unknown protein		Lus10012667 [exp]	38.6	0.7136
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	40.5	0.7397

Compare expression of checked genes

Lus10013992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.