Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28330 74 / 1e-18 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) AT5G44300 62 / 7e-14 Dormancy/auxin associated family protein (.1) AT2G33830 61 / 2e-13 Dormancy/auxin associated family protein (.1.2) AT1G56220 43 / 1e-06 Dormancy/auxin associated family protein (.1.2.3.4) AT1G54070 40 / 2e-05 Dormancy/auxin associated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013997 [exp] 134 / 2e-42 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015418 [exp] 132 / 1e-41 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10015318 [exp] 81 / 4e-21 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Lus10025446 [exp] 73 / 2e-18 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2) Lus10031488 [exp] 42 / 4e-06 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4) Lus10015193 [exp] 42 / 5e-06 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4) Lus10020661 [exp] 42 / 6e-06 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4) Lus10029881 [exp] 42 / 1e-05 AT5G27830 245 / 9e-80 unknown protein Lus10008142 [exp] 41 / 1e-05 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G047100 [exp] 62 / 9e-14 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5) Potri.001G164800 [exp] 45 / 2e-07 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1) Potri.013G014900 [exp] 43 / 3e-06 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4) Potri.005G024250 [exp] 42 / 3e-06 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4) Potri.003G070500 [exp] 39 / 8e-05 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05564 [flax] [poplar] Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence Show only first row Show all	>Lus10013996 pacid=23170064 polypeptide=Lus10013996 locus=Lus10013996.g ID=Lus10013996.BGIv1.0 annot-version=v1.0 ATGCTAGAGAAACTGTGGGACGACGTCGTTGCAGGGCCACAACCGGAGCGTGGCCTCGGCAAGCTCCGAAGGACCAGCGCCAAACCCCTGAATATCGATC ACGGGGAGAAGAAGATGGAGAAGTCGCTGTCGATGCCGGAGAGTCCGTCGACACCGGGCACGCCGAAAGAGAACGTGTGGAGGAGCGTTTTCGGAAATTT TAATGATAGAATGTTTGATAGTAAAATATTAAAATATCGAGAACCAATCTTGCCATTATTTAAAAATAATATATTTTAA
AA sequence Show only first row Show all	>Lus10013996 pacid=23170064 polypeptide=Lus10013996 locus=Lus10013996.g ID=Lus10013996.BGIv1.0 annot-version=v1.0 MLEKLWDDVVAGPQPERGLGKLRRTSAKPLNIDHGEKKMEKSLSMPESPSTPGTPKENVWRSVFGNFNDRMFDSKILKYREPILPLFKNNIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10013996 [exp]	0	1
AT1G28330		DYL1, DRM1	DORMANCY-ASSOCIATED PROTEIN 1,...		Lus10013997 [exp]	1.0	0.9653
					Lus10041093 [exp]	3.0	0.8941
AT2G31130			unknown protein		Lus10000990 [exp]	4.6	0.8677
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10018937 [exp]	5.1	0.8950
AT5G67170			SEC-C motif-containing protein...		Lus10006255 [exp]	6.0	0.8930
AT1G11400		PYM	partner of Y14-MAGO (.1.2.3)		Lus10007180 [exp]	7.4	0.8654
AT4G26100		CKL1, CK1	casein kinase 1 (.1)		Lus10021580 [exp]	14.3	0.8847
AT5G04850		VPS60.2	SNF7 family protein (.1.2)		Lus10028867 [exp]	16.9	0.8503
AT1G55340			Protein of unknown function (D...		Lus10010312 [exp]	18.2	0.8525
AT2G45990			unknown protein		Lus10036369 [exp]	19.0	0.8660

Compare expression of checked genes

Lus10013996 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.