Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33810 125 / 8e-38 SBP SPL3 squamosa promoter binding protein-like 3 (.1) AT1G53160 119 / 6e-35 SBP SPL4 squamosa promoter binding protein-like 4 (.1.2) AT3G15270 116 / 1e-33 SBP SPL5 squamosa promoter binding protein-like 5 (.1) AT2G42200 115 / 2e-31 SBP SPL9, AtSPL9 squamosa promoter binding protein-like 9 (.1) AT1G69170 115 / 3e-31 SBP SPL6 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) AT3G60030 115 / 2e-30 SBP SPL12 squamosa promoter-binding protein-like 12 (.1) AT2G47070 113 / 9e-30 SBP SPL1 squamosa promoter binding protein-like 1 (.1) AT3G57920 110 / 1e-29 SBP SPL15, MSC1 squamosa promoter binding protein-like 15 (.1) AT1G02065 110 / 1e-29 SBP SPL8 squamosa promoter binding protein-like 8 (.1.2) AT1G20980 111 / 4e-29 SBP ATSPL14, SPL1R2, FBR6, SPL14 squamosa promoter binding protein-like 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015421 [exp] 187 / 5e-62 AT2G33810 128 / 4e-39 squamosa promoter binding protein-like 3 (.1) Lus10018610 [exp] 120 / 1e-34 AT3G15270 127 / 7e-37 squamosa promoter binding protein-like 5 (.1) Lus10039846 [exp] 119 / 3e-34 AT1G53160 129 / 8e-38 squamosa promoter binding protein-like 4 (.1.2) Lus10021034 [exp] 116 / 9e-32 AT2G42200 199 / 2e-60 squamosa promoter binding protein-like 9 (.1) Lus10005548 [exp] 112 / 1e-31 AT3G15270 133 / 1e-39 squamosa promoter binding protein-like 5 (.1) Lus10023818 [exp] 115 / 2e-31 AT2G42200 191 / 3e-57 squamosa promoter binding protein-like 9 (.1) Lus10016275 [exp] 111 / 2e-30 AT2G42200 179 / 1e-53 squamosa promoter binding protein-like 9 (.1) Lus10004523 [exp] 115 / 3e-30 AT3G60030 499 / 5e-163 squamosa promoter-binding protein-like 12 (.1) Lus10010071 [exp] 115 / 3e-30 AT2G47070 631 / 0.0 squamosa promoter binding protein-like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G046700 [exp] 132 / 4e-40 AT1G53160 135 / 4e-41 squamosa promoter binding protein-like 4 (.1.2) Potri.011G055900 [exp] 131 / 5e-40 AT2G33810 129 / 2e-39 squamosa promoter binding protein-like 3 (.1) Potri.001G398200 [exp] 127 / 7e-38 AT1G53160 162 / 6e-51 squamosa promoter binding protein-like 4 (.1.2) Potri.011G116800 [exp] 126 / 8e-37 AT3G15270 159 / 5e-49 squamosa promoter binding protein-like 5 (.1) Potri.007G138800 [exp] 120 / 4e-35 AT3G15270 140 / 4e-42 squamosa promoter binding protein-like 5 (.1) Potri.014G057800 [exp] 117 / 6e-32 AT1G27370 137 / 3e-36 squamosa promoter binding protein-like 10 (.1.2.3.4) Potri.016G048500 [exp] 116 / 9e-32 AT2G42200 217 / 3e-67 squamosa promoter binding protein-like 9 (.1) Potri.015G060400 [exp] 114 / 2e-30 AT1G69170 153 / 4e-41 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Potri.010G154300 [exp] 114 / 2e-30 AT1G69170 152 / 3e-41 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Potri.002G142200 [exp] 112 / 2e-30 AT1G02065 243 / 8e-79 squamosa promoter binding protein-like 8 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03110 [flax] [poplar] SBP SBP domain
Representative CDS sequence Show only first row Show all	>Lus10013999 pacid=23170105 polypeptide=Lus10013999 locus=Lus10013999.g ID=Lus10013999.BGIv1.0 annot-version=v1.0 ATGGCGAGAGTTGAAGGAGGAAAGAGGACCCTAAAGGAGATCGAAGAAGACGACGAGGACCAGGATGAGCTTCTCGACGAAGCCTTGGGGTTCGATGTCG ACAAGAAGACTAAGAAGGGCAAGAGAGTCGTTGTAGGGTCCACGTCATCATGGTCTTCTTCCGGCGGAGGAGGAGGGGTGGCCGCGGTGAGCTGCCAGGC GGAGAATTGCAGCTCCGACATGGCCGGAGCTAGGAGGTACTACAAGAGGCATAAGGTTTGCGAGGTCCACGCTAGGGCTCCTGTGGTTCTTGTTGCTGGT GTTCATCAGAGGTTCTGCCAGCAATGCAGCAGGTTCCACGAGTTGTCGGAGTTCGATGACACCAAGAAGAGCTGCCGGAGGCGCCTGGCCGGACACAACG AACGTCGCCGGAAAAGCTCATCTGAAGGACCCAATTGA
AA sequence Show only first row Show all	>Lus10013999 pacid=23170105 polypeptide=Lus10013999 locus=Lus10013999.g ID=Lus10013999.BGIv1.0 annot-version=v1.0 MARVEGGKRTLKEIEEDDEDQDELLDEALGFDVDKKTKKGKRVVVGSTSSWSSSGGGGGVAAVSCQAENCSSDMAGARRYYKRHKVCEVHARAPVVLVAG VHQRFCQQCSRFHELSEFDDTKKSCRRRLAGHNERRRKSSSEGPN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10013999 [exp]	0	1
AT1G63820			CCT motif family protein (.1)		Lus10024655 [exp]	3.0	0.7570
AT5G13750		ZIFL1	zinc induced facilitator-like ...		Lus10035766 [exp]	4.2	0.7385
AT2G37390		NAKR2	SODIUM POTASSIUM ROOT DEFECTIV...		Lus10025294 [exp]	4.8	0.7870
AT2G41705			camphor resistance CrcB family...		Lus10028071 [exp]	6.0	0.7529
AT4G22970		RSW4, AESP	RADIALLY SWOLLEN 4, homolog of...		Lus10009044 [exp]	10.0	0.7610
AT3G43600		AtAO3, atAO-2, ...	Arabidopsis thaliana aldehyde ...		Lus10013393 [exp]	11.8	0.7378
AT5G15800	MADS	AGL2, SEP1	SEPALLATA1, AGAMOUS-like 2, K-...		Lus10026678 [exp]	12.0	0.7129
AT1G06260			Cysteine proteinases superfami...		Lus10041788 [exp]	12.6	0.6925
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	21.6	0.7152
					Lus10006666 [exp]	23.4	0.7435

Compare expression of checked genes

Lus10013999 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.