Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61390 122 / 4e-34 S-locus lectin protein kinase family protein (.1.2) AT1G11340 121 / 2e-33 S-locus lectin protein kinase family protein (.1) AT1G61370 118 / 2e-32 S-locus lectin protein kinase family protein (.1) AT3G16030 117 / 4e-32 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) AT1G61610 117 / 4e-32 S-locus lectin protein kinase family protein (.1) AT1G61430 117 / 4e-32 S-locus lectin protein kinase family protein (.1) AT1G61380 117 / 5e-32 SD1-29 S-domain-1 29 (.1) AT4G23180 116 / 9e-32 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT1G61490 115 / 2e-31 S-locus lectin protein kinase family protein (.1) AT1G67520 114 / 5e-31 lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031603 [exp] 160 / 3e-47 AT4G03230 558 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033741 [exp] 159 / 6e-47 AT4G21380 576 / 0.0 receptor kinase 3 (.1) Lus10033743 [exp] 158 / 1e-46 AT4G21380 608 / 0.0 receptor kinase 3 (.1) Lus10025891 [exp] 157 / 3e-46 AT4G21380 593 / 0.0 receptor kinase 3 (.1) Lus10039733 [exp] 150 / 1e-43 AT4G27290 615 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10028782 [exp] 149 / 3e-43 AT4G21380 649 / 0.0 receptor kinase 3 (.1) Lus10039731 [exp] 148 / 6e-43 AT1G11300 1112 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10018516 [exp] 148 / 8e-43 AT1G11300 699 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10039767 [exp] 143 / 4e-41 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G120300 [exp] 140 / 4e-40 AT4G21380 630 / 0.0 receptor kinase 3 (.1) Potri.013G150900 [exp] 138 / 2e-39 AT4G21390 635 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G134900 [exp] 129 / 2e-36 AT4G21390 662 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.005G014802 [exp] 125 / 2e-35 AT1G11330 454 / 5e-152 S-locus lectin protein kinase family protein (.1.2) Potri.001G437950 [exp] 123 / 3e-35 AT4G21390 406 / 5e-135 S-locus lectin protein kinase family protein (.1) Potri.001G441400 [exp] 125 / 8e-35 AT3G16030 523 / 1e-174 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.005G014900 [exp] 123 / 2e-34 AT4G21390 660 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G039400 [exp] 122 / 5e-34 AT1G11330 822 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.001G442200 [exp] 122 / 9e-34 AT3G16030 528 / 5e-176 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.011G038000 [exp] 121 / 1e-33 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10014000 pacid=23170089 polypeptide=Lus10014000 locus=Lus10014000.g ID=Lus10014000.BGIv1.0 annot-version=v1.0 ATGAATGAATTGAAGCTCATATCCAAGCTGCAACATACCTATTTGGTCAGGCTATTGGGGTGCTGTGTTGGGAGGGAAGAAAAGATACTGATATATGAAT ACATGCCTAATAGGAGCCTGGACATGTTTGTTTCATGTTCATCAGATAAGGGAAAACTAAACTGGGGAAAACGAGTAAAGATAGTGGAAGGTATAGCTCA AGGACTGCTAATCATCCACAAGCATTCAAGACTAAAAGTCATTCATAGGGACATGAAGGCAAGCGACATTCTAGATTGA
AA sequence Show only first row Show all	>Lus10014000 pacid=23170089 polypeptide=Lus10014000 locus=Lus10014000.g ID=Lus10014000.BGIv1.0 annot-version=v1.0 MNELKLISKLQHTYLVRLLGCCVGREEKILIYEYMPNRSLDMFVSCSSDKGKLNWGKRVKIVEGIAQGLLIIHKHSRLKVIHRDMKASDILD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27300			S-locus lectin protein kinase ...		Lus10014000 [exp]	0	1
AT3G54720		MFO1, HPT, COP2...	PRIMORDIA TIMING, Multifolia, ...		Lus10017223 [exp]	44.1	0.7589
AT1G12390			Cornichon family protein (.1)		Lus10000384 [exp]	47.8	0.7541
AT2G30080		ATZIP6, ZIP6	ZIP metal ion transporter fami...		Lus10031872 [exp]	59.1	0.7438
AT1G47670			Transmembrane amino acid trans...		Lus10025113 [exp]	96.3	0.7158
AT4G29400			Protein of unknown function (D...		Lus10012917 [exp]	98.6	0.6863
AT4G03415			Protein phosphatase 2C family ...		Lus10018570 [exp]	117.9	0.7066
AT5G42170			SGNH hydrolase-type esterase s...		Lus10003720 [exp]	135.4	0.7122
AT1G78780			pathogenesis-related family pr...		Lus10035732 [exp]	236.8	0.6877

Compare expression of checked genes

Lus10014000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.