Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28250 117 / 1e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015429 [exp] 162 / 3e-53 AT1G28250 132 / 2e-41 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G045400 [exp] 107 / 2e-31 AT1G28250 112 / 9e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014006 pacid=23170109 polypeptide=Lus10014006 locus=Lus10014006.g ID=Lus10014006.BGIv1.0 annot-version=v1.0 ATGGAGAGCAAGAAATCTACCTTATCGGCAACTGAGGCAGTCTTTCTGGGCGCGCTTACTCCAGGAGTCAACGCTCCTACATGGAACACTCTGAAATCGG CCTTCTTCTTGCTGGCTGCGTCTCTAGCAGTAATGCTCGGATTAGCTTTCGCTTCAAGCGACTCTTCCTTGGTGATTCACGTTGGGTTCCTCGTTCTCAT CACTGCTACCCTCTTCTTCCTCCTTAGTTGGTTCCTTTCACAGACTGGTCTGGTTTCAATCGAACACCAAATGCAGGATCTTGGTTTAGCTCCAAAGGAT CGTAACGAGTGA
AA sequence Show only first row Show all	>Lus10014006 pacid=23170109 polypeptide=Lus10014006 locus=Lus10014006.g ID=Lus10014006.BGIv1.0 annot-version=v1.0 MESKKSTLSATEAVFLGALTPGVNAPTWNTLKSAFFLLAASLAVMLGLAFASSDSSLVIHVGFLVLITATLFFLLSWFLSQTGLVSIEHQMQDLGLAPKD RNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28250			unknown protein		Lus10014006 [exp]	0	1
AT1G49170			Protein of unknown function (D...		Lus10042819 [exp]	2.8	0.8485
AT1G28250			unknown protein		Lus10015429 [exp]	3.3	0.8167
AT3G13950			unknown protein		Lus10029088 [exp]	5.3	0.8372
					Lus10042417 [exp]	6.9	0.8092
AT2G33735			Chaperone DnaJ-domain superfam...		Lus10014901 [exp]	7.1	0.8346
AT1G12390			Cornichon family protein (.1)		Lus10004320 [exp]	7.3	0.8316
AT5G25360			unknown protein		Lus10002164 [exp]	8.2	0.7916
AT1G11070			unknown protein		Lus10038307 [exp]	10.6	0.8310
AT5G54590		CRLK1	calcium/calmodulin-regulated r...		Lus10043083 [exp]	11.8	0.8097
AT1G08980		ATTOC64-I, ATAM...	ARABIDOPSIS THALIANA TRANSLOCO...		Lus10004466 [exp]	12.3	0.8291

Compare expression of checked genes

Lus10014006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.